SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002039 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000002039
Domain Number - Region: 16-118
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0534
Family Filamentous hemagglutinin FhaB, secretion domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002039   Gene: ENSTNIG00000015135   Transcript: ENSTNIT00000004030
Sequence length 311
Comment pep:known_by_projection chromosome:TETRAODON8:9:2966735:2970287:1 gene:ENSTNIG00000015135 transcript:ENSTNIT00000004030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQYTTATTTTGEQIVVQTANGQIQQQVQGQPLMVQVSGGQLITSSGQPIMVQAMSGSQG
QTIMQVPVSGAQGLQQQIQLVQPGQIQLQGGQTLQLQGQQGQPQQIIIQQPQTAITAGQN
QGQQISVQGQQVAQTADGQTIVYQPVNADGTVLQQGMITIPAASLAGAQIVQAGGTSTNT
TNSNQGTVTVTLPVSGNMVNAGGMVMMVPGGGAVPTMQRIPLPGAEMLEEEPLYVNAKQY
HRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMQRKRGDGGRFYSPKEKEEALLLAQ
ELFSISKVDLN
Download sequence
Identical sequences H3C1C3
ENSTNIP00000002039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]