SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002256 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002256
Domain Number 1 Region: 4-368
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.76e-59
Family Ankyrin repeat 0.0000594
Further Details:      
 
Domain Number 2 Region: 439-494
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000523
Family SOCS box-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002256   Gene: ENSTNIG00000000041   Transcript: ENSTNIT00000000007
Sequence length 503
Comment pep:known_by_projection chromosome:TETRAODON8:9:6035830:6038226:1 gene:ENSTNIG00000000041 transcript:ENSTNIT00000000007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DERGWIPLHEAAAQENKKILEIVFSASPPGTAQCRTLNGETPLFLAVVHGLRENATFLLQ
NGCSPELQNDEQDSPLVAAILNDQYDLATLLLRYRADVNQTGPLNRTALHESAFLGLENF
VYLLLESGADPNARDIKKKTPLALAAQKGHLNIVEVLLEKGAHVKAESESGSVLFDAAES
GNPDVISMLLDHGADPNLPIYSGHLPIHRVAYHGHILALEQLIPVTQLCAVKESGMSPLH
SAAAGGHAHCVEVLLKAGYDPNFMLHPRVRRNYDDERRSALFFAVANNDLQCSRLLLEAG
AMVNQDPINCLQVALRQGNYELINTLLKSGANVNYYSRINTTHFPSALQYALKDEVMLRM
ILNHGYDVKRCFDCPYGDNSHDYAPWMTSIIKDMVFCEVITVSWLRHLSAQVVRIMLDYI
DHVSFCTKLKETLEEQKQWLEICHIQRNARSLKHLCRLRIRERLSQLRLRAPVFIGFLPL
PERLKDYLRYKEYDIYSRGSILT
Download sequence
Identical sequences H3C1Y9
ENSTNIP00000002256 ENSTNIP00000002256 99883.ENSTNIP00000002256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]