SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002618 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002618
Domain Number 1 Region: 5-148
Classification Level Classification E-value
Superfamily E set domains 5.46e-19
Family Arrestin/Vps26-like 0.028
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000002618
Domain Number - Region: 148-188
Classification Level Classification E-value
Superfamily E set domains 0.00259
Family Arrestin/Vps26-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002618   Gene: ENSTNIG00000002392   Transcript: ENSTNIT00000002314
Sequence length 190
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:51772525:51774353:-1 gene:ENSTNIG00000002392 transcript:ENSTNIT00000002314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPEVDRPPVFSSGDVVSGRVLLDLFGEVRVSSLKLHAEFAKVHWTERSAGSSTAYTQNYS
DEVEYLNRREVLLQADNGEVSVLAGRHEFPFSFQLPEETLVTSFEGKHGSIRYWVKVKLH
PRATVKKIKKDFTVIEPIDINTPALLAPQAGTKDKLARAWYRNFGQVSVTAKIDRKGYTP
GEVIPVFAEF
Download sequence
Identical sequences H3C300
ENSTNIP00000002618 ENSTNIP00000002618 99883.ENSTNIP00000002618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]