SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002658 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002658
Domain Number 1 Region: 776-841
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.62e-20
Family TB module/8-cys domain 0.0000725
Further Details:      
 
Domain Number 2 Region: 265-329
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.7e-17
Family TB module/8-cys domain 0.00051
Further Details:      
 
Domain Number 3 Region: 643-769
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.59e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 947-999
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000981
Family TB module/8-cys domain 0.0022
Further Details:      
 
Domain Number 5 Region: 9-42,168-261
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000691
Family Growth factor receptor domain 0.0056
Further Details:      
 
Domain Number 6 Region: 431-552
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000973
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 523-645
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000847
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 8 Region: 890-936
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family EGF-type module 0.0024
Further Details:      
 
Domain Number 9 Region: 1060-1111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 10 Region: 851-900
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000356
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 11 Region: 1030-1074
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000196
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002658   Gene: ENSTNIG00000010055   Transcript: ENSTNIT00000001474
Sequence length 1116
Comment pep:known_by_projection chromosome:TETRAODON8:7:5374446:5384291:1 gene:ENSTNIG00000010055 transcript:ENSTNIT00000001474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPCLSAVVCPLTCLNGGVCLSRKSCHCPPGFTGRLCQFPLTQTQQAQAARGNKQPVYPM
SMKPDSLKLVGETSIGRTQMTQTHSVFTLPLSQGPHAPEVPFNVRVHHPPDTSVVIYPLD
QSDIKLPHKSSPRIFFTRHKPKGRCFQETTPKQACNSTPLPVLTNQEDCCGSVGNSWGQN
KCYQCPKLPNAPVKQTIVEDSGTTCPQGYKRFNDTHCQDINECIMQVVCQNGDCLNTLGS
FKCSCKAGWVLEGNGCVVCPSEAPAEQGQCFLMASESRGCEHALPTYLTQDMCCCTVGKA
WGPHCQPCPQIGTVAFSKICPAGKGYFYKERREIFAFPPIVYRKPDQDGSPRRRRLLSSR
PRVPGVRLVKKALGGKLSPCVVNMQIIMLYSHQTLSNSSVSIGPTVVKTTPHQVTIIRLT
PDNVPFETQTKVSDVDECKLNRNICGHGECESSLNGYVCHCHHGYHLNQIRNICEDNNEC
ELEPCGHGRGHCVNTDGSFKCLCRQGYKHMVQQGRPKCIDLNECSKQDICGVRGQCINLP
GSYKCECHGGFRIKSHRNPICEDVNECLNPDACPGELCENTVGSYECVPCLPGHEARGGT
CFADINECLKPGMCPNGHCENLPGTYRCLCNEGFLPSSDSKGCSDINECEDFRLCANGRC
INTEGSFQCQCYSGFQRTQEGSHCEDINECERPSNCLRGRCINSMGSYHCECQKGYVLVG
GRRCQDVDECAADRNLCQPYGTCENRPGSYSCVCNHGYTLSENKRSCEAIRVFVEEKKEC
YLNLDDTVFCDSVLATNVTKQECCCSIGVGWGDHCEIYPCPVSQSAEFHSLCPNGLGLYY
DEGLMYSLPAYHDIDECALFAEEICKRGHCENTLPGYECYCKKGFYYDSNLLECTDVNEC
EDPANCKNGRCVDTPGSYYCICAPPWTLATDRNSCVTPEEQADRTAAHKDVCFLHVDEGL
ICSQPKNDMVVTYSQCCCHYGRGWGPECNTCPPRHSGEQIKTFIESFWNSSPTPLVSDVF
SPAGDSSEEDSDECSCANGRCVRSYLGTMCECNTGFRLDYSRTRCLDIDECTEPGAGASP
CKNSQCVNTAGSYKCFCKHGFVPARRPNICVHRRTR
Download sequence
Identical sequences H3C340
ENSTNIP00000002658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]