SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002726 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002726
Domain Number 1 Region: 28-221
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.02e-37
Family Laminin G-like module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002726   Gene: ENSTNIG00000014019   Transcript: ENSTNIT00000000356
Sequence length 876
Comment pep:novel chromosome:TETRAODON8:21:5122742:5133303:-1 gene:ENSTNIG00000014019 transcript:ENSTNIT00000000356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPRYKLDFNRLDGDSVCPPLRSGQDDLPGFDLITQFQLDVIPLKGVRKVDGSTSLQVAYR
LDREANFQIPTMLNFPRGFPDEYSFMVTFRMIKNTVNKVWNVWQIMDEEGNKQAGLRLNG
DQQALEYFLIDADGNLQTVTFPGLSVLFNTRWHKVMIGVERNQVTLYVDCQPVDMRPIRG
KGPINTEGDTLIGRLDTDPDASVVFELQWMLIHCDPKRAQRESCNELPATEANSHASSCE
PEKAVQGPPGPPGPEGPRGSAGENGRDGRDGLPGPPGSPGIPGSKGEAGELGLPGQRGLA
GLPGPPGSSGPMGPRGPVGERGLPGFPGPPGPPGPPGKPGIPGDEGNIGPEGPPGPRGTA
GIAGPPGPPGPPGPVCPAACPAGPQGLPGIPGMKGHKGLAGEPDQDGKPGEKGVAGAEGP
QGPPGRMGDDGQRGPVGFPGSAGEKGDRGPPGFNGVPGPTGPPGAPGVEGTRGRQGLEGP
KGDDGAVGPQGEQGPKGDKGDVGEPGADGLHGIPGADGAKGEAGTPGALGIRGIVGIPGL
PGKPGAAGPSGAQGEPGADGPTGPVGLPGKAGEPGKPGEDGKPGDKGATGETGKQGPVGP
AGPPGIVGERGDKGDTGAKGMKGHTGLKGDQGPMGPIGPKGSQGDQGETGDIGVKGDQGP
PGVPGIKGESGEKGNRGSTGETGQPGQPGHEGLAGPAGARGLEGEPGPPGSPGPRGLPGP
KVNDENLREICSAVVEEQLAEFMKELLKKPAAIGAPGTPGPAGLPGPPGAAGEAGAAGPP
GPAGPKGHPGFFGIPGAPGQKGDPGVKGDKGDNGENGVGIKGSAGAPGAPGAPGTPGVGK
DGQKGERGETGVPGIPGASGPRGPSGPPGLCDPSTC
Download sequence
Identical sequences H3C3A7
ENSTNIP00000017027 ENSTNIP00000002726 99883.ENSTNIP00000002726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]