SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002804 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002804
Domain Number 1 Region: 231-518
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.31e-87
Family Complement components 0.0000112
Further Details:      
 
Domain Number 2 Region: 56-154
Classification Level Classification E-value
Superfamily E set domains 0.000000000714
Family SVA-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002804   Gene: ENSTNIG00000015449   Transcript: ENSTNIT00000000033
Sequence length 578
Comment pep:known_by_projection chromosome:TETRAODON8:1:14909474:14920798:1 gene:ENSTNIG00000015449 transcript:ENSTNIT00000000033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTFFPETWVWHCLNVSSETGQAELRLDVPDSITTWVTEAVGLSEEKGLGLARRAELRTFK
PFFVDFTLPYSLIRGEQTKVPLTVYNYLPTCAEVSPRTLGVVASKQGQRKKCVPPGEATP
TSIVFSVTELGPANITARAIAYSEPSCCSDEFQAAKSSNDVEERRTAIGMDYVRRTVLVE
PEGLPREYTYSVFFCPNDENHNEAFTLGVPHNIVPGSERATAFMIGDVMGPTLNNLDKLL
RLPFGCGEQNMIHFAPNVFVLKYLQKTRQLSPDVENEATDYLLQGYQRQLTYKRQDGSYS
AFGERDSSGSMWLTAFVLKSFAQSRGFIFIDPEELRAAKSWLITHQQSDGSFPAMGRILN
KDLQGGIHGKISLTAYVLAALLETGIATEEEKVAVAKAKDFLESNTYSAEDPYTTALSAY
ALALLRSPYAPLALRRLNHMAITQGTATRTVSSPQPSVVSAEVEMTAYGLLTYTLLGDVA
SALPVVKWLSQQRNSLGGFLFSPQDTCVALQALSEYAILSYVGGVNLTISLASTNLDFQE
SFELNRDNKKLLQSARIPSIPTGLFVSAKGEGCCLMQV
Download sequence
Identical sequences H3C3I5
ENSTNIP00000002804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]