SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002832 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002832
Domain Number 1 Region: 810-894
Classification Level Classification E-value
Superfamily DEATH domain 1.85e-22
Family DEATH domain, DD 0.0000313
Further Details:      
 
Domain Number 2 Region: 126-217
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 214-268
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000157
Family TSP-1 type 1 repeat 0.0008
Further Details:      
 
Domain Number 4 Region: 270-324
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000119
Family TSP-1 type 1 repeat 0.00059
Further Details:      
 
Domain Number 5 Region: 19-121
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000067
Family I set domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002832   Gene: ENSTNIG00000016621   Transcript: ENSTNIT00000002220
Sequence length 900
Comment pep:known_by_projection chromosome:TETRAODON8:17:3144059:3153214:1 gene:ENSTNIG00000016621 transcript:ENSTNIT00000002220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEAEVLPDSFPSAPAEPLPEFLLEPEDAFIVKNRPVQLRCRASPATQIYFKCNGEWVNQN
DHITRESLDQITGLVLREVEISVSRTQVEELFGLEDYWCQCVAWSSAGTTKSNRAYVRIA
YLRKNFEQEPLGREVRLEQEVLLQCRPPEGMPAAEVDWLKNEDVIDPSQDSNFLITIDHD
LIIKQARLSDTANYTCVARNVVAKRRSSTATLIVYVSGGWSSWTEWSECNAQCGRGWQRR
TRSCTNPAPLNGGAFCEGPPFQRVTCTTLCPVDGGWTEWAKWSACGTECTHWRSRECQAP
SPRNGGKHCSGSMMESKNCTEGLCARSLAPDTGVAVYAGLVGALLLCVILVLCVGVLAYR
RRCRHLHGDITDSSSALTAAFHPGNYKPSRQDNPNPLHPSAPPDLTATAGTFRGPLFSLQ
QGVNDSPHKIPMTTSPLLDPLPSLKIKVYNSSTLSSLELPADVCSDGEILSLKSVGTVGR
ERDCYGHTLSREPGLSTSATLGNLGGRLTIPNTGVSLLVPPGTIPQGKFYEMYLIINKWD
KMTLPSEGSQTVLSPVVSCGPSGMLLNRPVVLTLPHCAQLDSPTPDWTLTLKTQTHQGAW
EEVLTVGEETLSSPCYLQLEEECCHLLMEQLGTYGLVGQSCPPQPACKRLQLALFAPRAP
CLSLDYSLRIYCIHDTPHALKEVLDLERSLGGVLLEDPKPLPFKDSYHNLRLSIHEIPHT
HWRSKLLAKYQEIPFYHIWSGSQRPLHCTFSLERSSLAVSQLACKICVRQVEGEGQIFQL
HTDIQETLPPHSPLPSGGSCLPSSQVGPYAFRLPDSIRQKICASLDAPSARGCDWRLLAR
SLGFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVMTTDGDC
Download sequence
Identical sequences H3C3L3
ENSTNIP00000002832 99883.ENSTNIP00000002832 ENSTNIP00000002832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]