SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003521 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003521
Domain Number 1 Region: 188-295
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-27
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 4-99
Classification Level Classification E-value
Superfamily Kringle-like 1.91e-26
Family Kringle modules 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003521   Gene: ENSTNIG00000015625   Transcript: ENSTNIT00000001674
Sequence length 427
Comment pep:known_by_projection chromosome:TETRAODON8:12:4195664:4214753:1 gene:ENSTNIG00000015625 transcript:ENSTNIT00000001674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVFSECYTANGEDYRGFQNQTSLHGGKPCLFWNETFQHPYNTLKYPNGEGGLGSHNYCRN
PDGDVQPWCYIADYEDGIYWRYCDIPTCQMPGNLGCYRDSGDPPTLSGTSETSNKLTIQN
CISFCRKQRYKLAGMESGYACFCGNEVDQGNRDESPSMECNHVCFGDHTQPCGGDGWVII
FDTRVGACGGNYSSPSGVIYSPDFPDKYSPGRVCYWTVQVPGSSAILFNFTFFDISDQTD
MVELLDGYTNQVVARFDWRSPPREAVNVTGDFVILYFYSDRTNQAQGFALLYQAFREVGV
ELPSSTAGPPMAGGLTEKPNSTSNERSSQIFYVITSSPGKPEHSMPVWTIYALSALLVLT
VIAMLAKLLLHITVKSPNIPTVSGSDSCSQSTASSEPWIILYRPSTISLFKKKLKNHHSD
LSPLVGN
Download sequence
Identical sequences H3C5K2
ENSTNIP00000003521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]