SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004763 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004763
Domain Number 1 Region: 8-156
Classification Level Classification E-value
Superfamily EF-hand 2.03e-30
Family Calmodulin-like 0.037
Further Details:      
 
Domain Number 2 Region: 195-225
Classification Level Classification E-value
Superfamily Mitochondrial carrier 0.0000017
Family Mitochondrial carrier 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004763   Gene: ENSTNIG00000002287   Transcript: ENSTNIT00000004908
Sequence length 225
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:50290709:50292202:1 gene:ENSTNIG00000002287 transcript:ENSTNIT00000004908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRALRTFLLPGARCWDADSERSYQDLFERLDTNKDGKVDVAELRAGLKAMGIFRLGAAQ
KIVSSGDQNKDGCLDFSEFSKYLKDHEKKLRLTFKSLDRNNDGRIDASEIQQSLAELGHR
HQPRERAEDPAEPSMDIDGTMMVNWNEWREHFLLYPAPNLEALIRYWTPGGVLDIGDSLA
IPDEFTEEEKSSGVWWKHLVAGAAAGAVSRTGTAPLDRMKVFMQV
Download sequence
Identical sequences H3C941
99883.ENSTNIP00000004763 ENSTNIP00000004763 ENSTNIP00000004763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]