SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004791 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004791
Domain Number 1 Region: 252-404
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000000733
Further Details:      
 
Domain Number 2 Region: 407-564
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.41e-42
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000544
Further Details:      
 
Domain Number 3 Region: 13-117
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-34
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 4 Region: 626-794
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-32
Family MAM domain 0.0068
Further Details:      
 
Domain Number 5 Region: 122-240
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-29
Family Spermadhesin, CUB domain 0.00000605
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004791   Gene: ENSTNIG00000007974   Transcript: ENSTNIT00000004936
Sequence length 916
Comment pep:known_by_projection chromosome:TETRAODON8:15:1346538:1364773:1 gene:ENSTNIG00000007974 transcript:ENSTNIT00000004936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKCGGEIEIHDADYLTSPGYPGAYPPSQQCVWVITAPEPGQKILINFNPHFDLEDRDCKY
DYVEVYNGGDERAPMLGKFCGKIAPSPIISTGGQLLIKFVSDYETHGAGFSVRYEVFKTG
PECSTNFTAPRGVIKTPGFPEKYPNNLECTFMIFAPQMSEILLEFQSFDMESDPTPPSGA
VCRYDWLEIWDGFPAVGPHIGRYCGLASPGRVTSYTGILSMTITTDNAIAREGFSASYTI
RERSLPHEDQEFICMEPLGMESGQISAQQIKASSQYNSNWSPERSRLNYHENGWTPSDDT
VREWIQVDLGFLRFVTAIGTQGAISKETKKHYFVRSYRVDVSSTGEDWVTVKDNSKQKIF
QGNHNPTDVAVAFLPKQTLARYVRIRPLTWEQGICMRFEIYGCRTSDYPCSGMLGMVSGQ
ISDAQISVSSSADRGWVAENARLLTGRTGWTGQQAKQPFRNEWIQVDLGQEKMLSGVMIQ
GGKHRDKNVFVKKFRVGHSLDGEDWAMVREDNGTRPKIFSGNQNHDTPELRLVAAVRTRF
VRIYPDRATAEGLGLRLELTGCDLDAAPTAVPTTPAVTDCEDGHLGCGGETEAPYDYDAT
TGKTRFCASECELVPTPRCSAAAYIWFACNFDFSSYCGWTAEPGKGATWLIHPGGASAGH
RGPTFNHTGGRGNFVYVQLSKREPPGGTGEDEDGDKVARLASVPIPAPDSHLCMSFWYHM
LGEHAGALHVNLRTEAEGTQVLWTVRGHQGSQWKEGRVLLPPAKVSYQVILEGVADKRSP
AHIAVDNIQIMDGLADDECTASRRPNGCVSPPDPRAPTPPPSFVPPMDSLSQDTSELSGP
GNMLKTLDPILITIIAMSALGVVLGAVCGVVLYCACSQGSMSDRNLSALENYNFELVDGV
KLKKDKMNGQTNYSEA
Download sequence
Identical sequences H3C969
ENSTNIP00000004791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]