SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004939 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004939
Domain Number 1 Region: 22-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.39e-17
Family Growth factor receptor domain 0.002
Further Details:      
 
Domain Number 2 Region: 93-139
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000162
Family Ovomucoid domain III-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004939   Gene: ENSTNIG00000002421   Transcript: ENSTNIT00000005085
Sequence length 143
Comment pep:novel chromosome:TETRAODON8:Un_random:52113645:52114229:1 gene:ENSTNIG00000002421 transcript:ENSTNIT00000005085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPVSAPLLLIPVLLALPARTAPGCGPCEPAVCAPLPLEGCRSGSVLDSCGCCSVCAAAE
GEACGGRRAGARRCAQGLECIKGNPDKKNKGGVCVCKSDYEVCWSDGVTYSSGCELRSAL
AAQAQGQQPVRVQNKGRCATEPV
Download sequence
Identical sequences H3C9L7
99883.ENSTNIP00000004939 ENSTNIP00000004939 ENSTNIP00000004939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]