SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005084 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005084
Domain Number 1 Region: 127-267
Classification Level Classification E-value
Superfamily SH2 domain 1.09e-38
Family SH2 domain 0.00000418
Further Details:      
 
Domain Number 2 Region: 230-342
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.17e-21
Family Protein kinases, catalytic subunit 0.00000754
Further Details:      
 
Domain Number 3 Region: 101-139
Classification Level Classification E-value
Superfamily SH3-domain 0.000000226
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005084   Gene: ENSTNIG00000002534   Transcript: ENSTNIT00000005230
Sequence length 370
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:52784378:52787167:-1 gene:ENSTNIG00000002534 transcript:ENSTNIT00000005230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVGSKKEEKAPGKGARDLELNNPAHTAHYVKDPTATNSRGVSERRLPWRCTTMRPFTK
ATLASRRATVCRSWRSGFPRRSEVFFSRVRWVIRRVLCRSGEWWKAKLTSTGEEGYIPSN
YVAKDTLETEEWFFKGISRKDAERQLLAPGNILGSFMIRESETTKGSYSLSVRDSQAGDT
VKHYKIRMLDNGGFYISPRITFSTLQELVSHYRQHSDGLCQTLSKACLNPKPEKPWEKDA
WEIPRSSLKLEKRLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFMAEANLMKSLQH
DKLVRLHAVVTKEEPIYIITEFMEKGTTRWRFFTWLTRICFTGSLLDFLKSDEGNRIQLP
KLIDFSAQVS
Download sequence
Identical sequences Q4TC30
99883.ENSTNIP00000005084 ENSTNIP00000005084 ENSTNIP00000005084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]