SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005149 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005149
Domain Number 1 Region: 133-225
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 4.71e-33
Family TATA-box binding protein (TBP), C-terminal domain 0.00000394
Further Details:      
 
Domain Number 2 Region: 218-307
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 2.83e-31
Family TATA-box binding protein (TBP), C-terminal domain 0.00000924
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000005149
Domain Number - Region: 96-134
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.0392
Family NAD kinase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005149   Gene: ENSTNIG00000002597   Transcript: ENSTNIT00000005295
Sequence length 309
Comment pep:novel chromosome:TETRAODON8:Un_random:53279532:53281693:1 gene:ENSTNIG00000002597 transcript:ENSTNIT00000005295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDESALERYFEDSIANDSGFLLEEELSIGSPTLSSTYLPGKAGLSRGSGEELDLSFLPDE
LGTQEEPSRHNDTAQTEAQAASQDSAVCLDYNSQDSTGASLSGGGALNSPFCPMTPMTPM
TPMTPVTERSGIIPQLQNIVSTVNLGCPLDLKFIALQARNAEYNPKRFAAVIMRIREPRT
TALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPARFLDFKIQNMVASCDVCFPIR
LEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERAEIYEAFENIY
PILRGFRKQ
Download sequence
Identical sequences Q4TBU5
99883.ENSTNIP00000005149 ENSTNIP00000005149 ENSTNIP00000005149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]