SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005726 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005726
Domain Number 1 Region: 162-292
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.6e-25
Family Synaptotagmin-like (S variant) 0.04
Further Details:      
 
Domain Number 2 Region: 18-127
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.06e-22
Family Synaptotagmin-like (S variant) 0.024
Further Details:      
 
Domain Number 3 Region: 325-507
Classification Level Classification E-value
Superfamily vWA-like 1.11e-16
Family Integrin A (or I) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005726   Gene: ENSTNIG00000003152   Transcript: ENSTNIT00000005874
Sequence length 566
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:13310753:13346265:-1 gene:ENSTNIG00000003152 transcript:ENSTNIT00000005874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGEANMATVGDFDPLNSSVPATKIEVTVSCRNLLDMDTFSKSDPVVVLYMQGLGTKEWRE
FGRTEVIDNTLNPDFVRKFVMDFFFEEKQNLRFDVYNVDTRSSNFSKHDFLGQTFCTLGE
IIGSVGGRLERTLSATGFQFLSKARSPFFGIKDIGIPGKKCGTIIFAAEELSNCRDIATM
QFCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVIKNNLNPVWQPFTIPVRALCN
GDYDRTVKVDVYDWDRDGSHDFIGEFTTSYRELSRGQNQFNVYEVLNPKKKGRKKKYVNS
GTVTLLSFKVESEYTFVDFIRGGTQLNFTVAIDFTASNGNPSQPTSLHYMNPYQLNMYAM
ALKAVGDIIQDYDSDKLFPAYGFGAKLPPDGKISHAFPLNSQADNPNCVGIDGVLEAYFQ
SLRTVQLYGPTNFAPVISQVARCAAEVTDGSQYFVLLMITDGVISDMAQTKESVVNASSL
PMSIIIVGVGPAEFDAMEELDGDDVRVSSRGRFAERDIVQFVPFRDYIDRSGNQVLSMAR
LAKDVLAEIPEQVLSFMKSRGIGPRP
Download sequence
Identical sequences H3CBV4
ENSTNIP00000005726 ENSTNIP00000005725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]