SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005760 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005760
Domain Number 1 Region: 816-1006
Classification Level Classification E-value
Superfamily Nucleotide cyclase 4.4e-64
Family Adenylyl and guanylyl cyclase catalytic domain 0.0001
Further Details:      
 
Domain Number 2 Region: 42-433
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.35e-51
Family L-arabinose binding protein-like 0.00045
Further Details:      
 
Domain Number 3 Region: 512-784
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.99e-45
Family Protein kinases, catalytic subunit 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005760   Gene: ENSTNIG00000003180   Transcript: ENSTNIT00000005908
Sequence length 1088
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:57302493:57309972:-1 gene:ENSTNIG00000003180 transcript:ENSTNIT00000005908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKAHTLLGLGVLVAAAAANRVLDECLRGNKKYTMNVVLLEDDTYEWSRPFVQAAVERAI
EEDRRENDRHGIDFNLTANYNGFNTTMYNRQGCGSSTCEGVAILKMLHSNREIGCVMLGP
SCTYATFQLVDDEIGLSLSIPVISAGSFGLSCNYKSKLTRILPPARKISDLLIHFVGEVL
PFKPKWQNAYVYRKSVEDTTEDCFWYINALEAASANFARNVTRQMLRTEDSLRDVLTTTQ
RHSNIFILCGSPNDVVSVKSKLTSPIIEETLFILLDVYNPSYYVNVTSSQAMRDVLVITL
PQRNYTKGPHWALNDTSVGWQINDYVAGYHDGALLFGKVLRERILSQRNPKRTLDVPLSD
NPFGNASFYGMGGHYVLDKYGDRDVNFTIIYTSALTEKYEILAVFDTSLNKTRVVAVDPA
LHWKGGVLPDDRPENSEELNIQDVIMIVLSVSVIVASAIALIFYRQNRKERLMQKKWSHM
DGQLFSPLDEKEVSLKIEEDRRKDSTYFSRRCRYDKKPVILKELKQTEGDFSEEQKIELN
TLLGIDYYNLTKFYGTVKFEYNVFGVFELCQRGSLRYILNDKISYPDETFMDMEFKISVM
YDIAKGMSYLHSSNIQVHGRLKSTNCVVDNRMVVKITDFGCHTILNPGRDLWTAPEHLRK
NGVSQKGDVYSYAIIAHEIVMRRSPFYTQSCSNPAEKLYRVQFPTGMGFFRPDLNFEGTS
EREIELCMLIRNCWDEDPERRPDFKKIELTLGKIFSNMHNQASETYMDNLIRRLQMYSRT
LEHLVEERTSLYKAERDRADRLNFMLLPGPVVRSLKETGKVEPELFEEVTIYFSDIVGFT
TLCHYSTPMEVVDMLNDIYKNFDSILDHHDVYKVETIGDAYMVASGLPNRNGDRHAVDIA
HMALDMLSFVKTFELLHLPGIPLWIRIGVHSGPCAAGVVGHKMPRYCLFGDTVNTASRME
STGLPLRIHTSQSTINILQRTDCKFEYEKRGETYLKGKGKGMTYWLTGVAGNKYNLPTPP
TAENFQRLQQDLAEMIVSSLEKRVDRDSSFKRTLSTKVHQRESSGSLQSDGLPEYFHLAV
ADPTSTFL
Download sequence
Identical sequences H3CBY8
ENSTNIP00000005760 ENSTNIP00000005760 99883.ENSTNIP00000005760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]