SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006269 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006269
Domain Number 1 Region: 436-542
Classification Level Classification E-value
Superfamily Homeodomain-like 4.21e-36
Family SWIRM domain 0.0000795
Further Details:      
 
Domain Number 2 Region: 156-211,251-288
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000638
Family DNA topoisomerase II binding protein 1, TopBP1 0.059
Further Details:      
 
Domain Number 3 Region: 607-660
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000336
Family Homeodomain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006269   Gene: ENSTNIG00000003672   Transcript: ENSTNIT00000006418
Sequence length 1087
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:34090188:34099126:1 gene:ENSTNIG00000003672 transcript:ENSTNIT00000006418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TASGTGSGGPTTGSVGSGAAVGRKKDGGPSGKFWESSETVAQLETVRLWIGKHYKKYVQN
DSPSSKSLAGLVVQLLQFQEDAFGRRVNNPALTKLPAKCFLDFKAGGALCHILGSAYKFK
SEQGWRRFDLQNPSRMDRNVEMFLNVEKNLVQNNCLTRPTVYLSPDIEQKQASKLKDIIK
RHQGSITDDKSKATHHISPSLPQQDEEEWLRPVMRKDKQVLVHWGFFPDSYDTWLSAGEV
DGDVEEPPSADRPWKVHAKWVLDTDAFNEWMNEEDYEVDDNKKPVSFRLRIFPKEEESSR
TPDRKERKANSAGKKRRRSPSPPSTPAESRKKGGKKGNPGVHWKRRGHRGEEEDTEEDLS
KDMDDSSAGASMEEGSMSKNTNSKRESENTPVKGGNVADLDDMEDDSVLSGKDDEEQSKA
EVNRLMDASEDNVCEQTHHIIIPSYSAWFDYNCIHEIERRALPEFFNGKNKSKTPEIYLA
YRNFMIDTYRLNPQEYLTSTSCRRNLAGDVCAIMRVHAFLEQWGLVNYQVDADSRPLPMG
PPPTPHFTVLADTPSGLIPLNHRPPPIPPPQQMPNFADKSKEKSIDLQNFSLRTDLYKKM
PKAKTGSSTREWTEQETLLLLEALEMYKDDWNKVSEHIGSRTQDECILHFLRLPIEDPYL
ESTEACLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKAALEEFSRVREEVPT
ELVEAHVKKVQEAARSTGKVDPTFGLESSGIAGTAPEEPEKTEAPEAEKMDTDSDSQQAD
KFPLISVNRVHQGQLFTFPSEKKTSPSDKDKEEAMDTSSEQDKEEKTSSEEGKDKRKKVE
HDIDEGNIATAAAAALASAATKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELE
TIMDREKEALELQRQQLLTERQAFHMEQLRYAEMKARQQMEQQAHAHGQAPGPGPLSAHP
PPGMHPGGPQPHHGAPVPHHGGPPHGGAMHPGYPPMGHHPMAPHHPGQTGELPSSGPMGP
GQPMPGRMMPGPPTAGPPPGGMPPMMPPRHPGAPNGMYPGPPPAQPDAVPPVAPPVGPPV
PPSARVP
Download sequence
Identical sequences H3CDE6
ENSTNIP00000006269 ENSTNIP00000006269 99883.ENSTNIP00000006269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]