SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006291 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006291
Domain Number 1 Region: 805-913
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-23
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 2 Region: 282-409
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 244-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000163
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 84-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000718
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 622-734
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000022
Family Growth factor receptor domain 0.0068
Further Details:      
 
Domain Number 6 Region: 4-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000559
Family EGF-type module 0.019
Further Details:      
 
Domain Number 7 Region: 174-216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000454
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006291
Domain Number - Region: 744-788
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0134
Family TNF receptor-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006291   Gene: ENSTNIG00000004435   Transcript: ENSTNIT00000006440
Sequence length 991
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:8487466:8528440:-1 gene:ENSTNIG00000004435 transcript:ENSTNIT00000006440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVDECAEGSDDCHIDALCQNTLKSYNCICKPGYKGDGKQCEVEDICKPDVWAPGCLRLTL
QQAFVPTNQACKPCYHCFCLSILIDVDECADNNGGCQQVCVNTMGSYECQCTDGFFLSDN
QHTCIHRSDDGNQCLFKKTSCLLICREAPGKGGVSCESSSFELAKNQKDCTLTCNYGNGG
CQHTCDDTDTGPVCGCHQKYALHSDSKTCVGKDKNAMLEKMRLVVSCVLHVRKHVSVLLC
AETCAVNNGGCDRTCKDTATGVRCSCPVGFTLQPDGKTCKDIDECLENNGGCDHFCRNTV
GSFECSCQKGHKLLTDERTCQDIDECSFERTCDHTCINYPGSYECLCNKGFILYGLTHCG
DVDECSINNGSCEHACVNTQGSYECVCPPAQKLHWNKKDCVEVVKCLPNGKPAPRAQLTC
TKSAGAEVCSLSCPSNALFFAESENSYTLSCGVPVHPGKTPQKRNATTSLPTCADTDTLA
PPIKQKARFKIKDAKCHLRPRNKKKSRDSSRQRAPFPCTDDCQVTFVNLKCDSSKKRRRG
RKSPTKEVSHITAEFEMEMKEEETSDSCNVDCVREKMKQKLQSAMRTLRKSINKQQFYIQ
FSGTEYEVAQKPSKGPEGVEACSTGQVLQDGKCVSCSVGTFYSGEQEQCIQCPPGTYQDT
VGQLSCEPCPSSEGQGIAGAKNVSQCGGQCPAGHFSADGFRPCQLCPLGSYQPEPGRVLC
FSCGGGLMTKYEGSVSFRDCEAKVHCAPGHYYNSSTHRCIRCPAGTYQSEFGQNYCITCP
GNTTTDFDGATNVSHCKNQLCGGELGEYTGYIESPNYPGDYPSNVDCVWTINPPHKRRIL
IVVPEIFLPIEDECGDVLVMRKSALPTSITTYETCQTYERPIAFTSRSRKLWIQFKSNEG
NSGKGFQVPYVTYDEDYQQLIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYF
RYTAQESKEMFPRSFIKLVRSKVTRFLRPYK
Download sequence
Identical sequences H3CDG8
99883.ENSTNIP00000006291 ENSTNIP00000006291 ENSTNIP00000006291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]