SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007186 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007186
Domain Number 1 Region: 403-667
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-52
Family YWTD domain 0.0000000141
Further Details:      
 
Domain Number 2 Region: 316-395,667-717
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.95e-20
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 3 Region: 194-233
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000537
Family LDL receptor-like module 0.00037
Further Details:      
 
Domain Number 4 Region: 146-186
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000144
Family LDL receptor-like module 0.00051
Further Details:      
 
Domain Number 5 Region: 108-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000798
Family LDL receptor-like module 0.0005
Further Details:      
 
Domain Number 6 Region: 29-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000929
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 236-273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 278-315
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000055
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 9 Region: 70-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000628
Family LDL receptor-like module 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007186   Gene: ENSTNIG00000004537   Transcript: ENSTNIT00000007344
Sequence length 856
Comment pep:known_by_projection chromosome:TETRAODON8:18:4561108:4565862:1 gene:ENSTNIG00000004537 transcript:ENSTNIT00000007344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLMIHLMRAWLLYSVFTTLQYLSFTDAAFTCSSSQFMCGNGRCITRRWICDETDDCGDGT
DELLETCASKTCMQSDYSCGAPLYQCIPGRWHCDGKADCDNEADEKNCTAKQCKEDEFQC
ANGQCISASFVCDEDNDCSDGSDEASCPKPTCSSRSFQCNNSVCVPARWRCDGDRDCADG
SDEWPENCEGRQNKPAPRCRSHEFQCADGECIHSSWRCDGGVDCKDRSDEANCSRPACSQ
DQFRCLDGACIAGALQCDGMRDCTDHSDELDCHKVKACEGPTMFKCRTGECISMEKVCNK
QADCRDSSDEPARECDIDECQVDNGGCSHNCSDLKVGFNCSCPTGYSLKMDKKTCEDIDE
CAEPDTCSQICINLAGSYKCDCLEGYQIDPLTKTCKAQAGVVPMLYFTNKHEVRRMTLDR
SEYVRLIPQLKNVVALDIDMPNGRIFWSDLFLKKIFSSRIDVAGNSSHHIAVIESGIEAP
EGIAVDWIHGNIYWTDSALKTVSVAATDGSRRKTLITENLEKPRAIVVDPVNNFMYWTDW
GEQAKIEKCGLNGVDRFALVTDNIVWPNGITLADVTNNRLYWVDSKLHTLSSIDVNGGTR
HSILFSEEHLSHPISLTVFENQVFWTDMDHSAVMSANRLTGNDIKILATDLDQPEDIILY
HDLKQPTGTNWCRESNSMNGGCEFLCLPAPLINQRSAKFTCACPDNMVLGPDRRKCVTGP
VVPPAEGRSEAPLQPKAATTTSPSPVTTATTTARRQTDPTSQAAVTAQGNKLPKEAPSSH
PVALYVVLPIMVMTLLVFGAVLVWRHWRLKNTNTIHFDNPVYQKTTEDELHICRNGSDGY
IYPERQMLRMDDMDFA
Download sequence
Identical sequences H3CG09
ENSTNIP00000007186 99883.ENSTNIP00000007186 ENSTNIP00000007186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]