SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007253 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007253
Domain Number 1 Region: 273-401
Classification Level Classification E-value
Superfamily Second domain of FERM 8.9e-28
Family Second domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 404-508
Classification Level Classification E-value
Superfamily PH domain-like 2.7e-23
Family Third domain of FERM 0.011
Further Details:      
 
Domain Number 3 Region: 36-141
Classification Level Classification E-value
Superfamily PDZ domain-like 1.04e-17
Family PDZ domain 0.0099
Further Details:      
 
Domain Number 4 Region: 186-267
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000163
Family Ubiquitin-related 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007253   Gene: ENSTNIG00000004604   Transcript: ENSTNIT00000007411
Sequence length 1554
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:14643595:14652538:1 gene:ENSTNIG00000004604 transcript:ENSTNIT00000007411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVQERSRSPSRKTSRVEQVVGRWLRRSRDLGSRSHSLSRDRRADGKTAESGQSDPRNYS
FRFNIQIQRDAELHSHGLTLSGQSPILVQDVTPGGPADGRLVPGDQLVKISNVAVDDLTP
EQAAEIIRECPDALTLTVLRTMLGPKSSFITPEKRAKLRSNPVKVHFAEEVEVNGHSQGN
SLLFLPNVLKVYLENGQTKAFKFEPSTTVKDIVMTLKEKLSLSRIEHFALVLERQPSVTK
LLLLHEEERIEQVVQRKEAHDYRCLFRVCFMPKNLQALLDEDPASFTYLYLQGVNDVLQE
RFAVEMRCNTALRLAALHMQERLASCGQSPKTNLKTLTKTWSIDNFVSSTLLRNMREKEL
KKAITYHMKKSQSQHDPKQRGLSVEQARIHYLEELGDLKSFGGKSFSATMMLQDRESMVT
LLVGARYGVSQVVNHKLSILSTLTEFSSITRIELLPESDKVSLVKVYLQDIKPITLLLES
VAAKDMSCLIAGYCRLFIDPNLNVFPWMDEDRKHRVSAEEGAAVNQSHVCPPNQHQGEFV
GVSAAFACVSAGYVSRCGSDSDSSDADAGPPGPQVSHEEKPRPRLRSSSDPPPSEASDSC
RSDSHGFTSPSSDSLDALEEDDFIACSSSADTSLCFAQLSQVVDLLPSPPEASEEDEAPD
LGGRKVSEETDEPVQTAGESGSAGGHTAPPSTSSLSSNADCVFNFDRGDARCYYNLCSNI
TPDSARSPPHPQPEPAEEWDRAAADLEGVPILQPPPGFGDSSSDDEFFDARDRFTSPEEP
TSGAKPRGAEGKPDLSSLGAGKHRDADHSRGVKEEGGARDAVPQLGRRSRKRRSFLDSDY
TSRVSFPQPDPELQMLSLDPEPSEQTQNPSPTVSSLTHSEGEPAQLESKPIPARRPAPPS
APGGDGQTRKQEMEMEPDSMESKSVTIAMEAAAPSITVVRCRVDPDGKECSDRRSFAGAP
ADPDDPGQSSLSGARVGPPEKSRDQEGKITAEGEKDDWGAATRRSRGPPFNRGYDRAITS
ITAKLGAATEVTCPTFYSGPRLKGERTPEGVACEKVEQLRSVDSLQTPTGPPRSGMPVDG
VEPPPPTRFPFQTCSPGFMGRLSASTLRGKIQQLPRYLSRSQESLNQPGGAPGPAGRQHA
SEKVGVTITGVDDVTRSADLEMESVDSDDSDTTVTGSEVDGEYLADSAAAPPPLPVQAEP
RAPSLPPQAGPSGSTPGPITQPPASLLNSFHRDNSAAKTDTPGPARTFPSSPLVVTTQNL
NGPGPPFHSQAAPAWTPAPAEPAPLFKPGPGCTSALASACESWAEGPQAPLDACGCPPVY
SSCFGSGDGFDEELTVFEFSCRSQSSSATQSCGGASELSPLLSPLSDASTPPLSHRDAIS
RLAQQRYPEPPAGFQVLRLDVDKLLSLLEHGSAERCVSARHPRETCPAHFTENKRVLQVE
ARRLMSGCQKVVGDQRSPGDMLGALAESFRTLVDLAAVCLCFSECDRCERRHAEAVAGLA
DVARSFRDLCLAAERVSSRRSCQDLSRKLLAKQCTALTASVFCLTQLFRTLTAL
Download sequence
Identical sequences H3CG76
99883.ENSTNIP00000007253 ENSTNIP00000007253 ENSTNIP00000007253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]