SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007744 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007744
Domain Number 1 Region: 1216-1502
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.72e-52
Family Tandem AAA-ATPase domain 0.00017
Further Details:      
 
Domain Number 2 Region: 1513-1721
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.67e-46
Family Tandem AAA-ATPase domain 0.00082
Further Details:      
 
Domain Number 3 Region: 1005-1178
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 6.67e-46
Family Sec63 N-terminal domain 0.0018
Further Details:      
 
Domain Number 4 Region: 420-660
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.21e-41
Family Tandem AAA-ATPase domain 0.00031
Further Details:      
 
Domain Number 5 Region: 670-883
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.75e-38
Family Tandem AAA-ATPase domain 0.00064
Further Details:      
 
Domain Number 6 Region: 2041-2123
Classification Level Classification E-value
Superfamily E set domains 0.00000000105
Family Sec63 C-terminal domain-like 0.0042
Further Details:      
 
Domain Number 7 Region: 883-988
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000272
Family Hypothetical protein PH1932 0.072
Further Details:      
 
Domain Number 8 Region: 1721-1823
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000544
Family RecQ helicase DNA-binding domain-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007744   Gene: ENSTNIG00000005079   Transcript: ENSTNIT00000007905
Sequence length 2125
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:35837687:35866478:1 gene:ENSTNIG00000005079 transcript:ENSTNIT00000007905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPPRLTGALRSFSIVSRKEDPDEQRFDLKMKRQKRRELFAKEGLTWQKIVHFCSQTRDK
ARLQAANQELKSLLSAAKQIVGCDHGQEAIESAAVFLFEIFYNKELVGTEETRAIKHMFG
PFPSSGADTSCSSVARLVAALGDAQVEDFIQSSRLRTPGRPFGCNLAFSYEGYALDPLEE
LSSSGPHQDKDSLDFMNFLNVQQSGRKATEKDGRPLTPGAGNLLRSEVEKYLKGGDVVSS
SPEELCTSLFEMLASQRSDDELQNELFELLGPDGLEMISTLLQKRTAVVSQLAAIPPDRS
SYPAELCDPCGRASGDVAKPTYGCQVTIQSEQERQMMKMYRREEKKERKRGKGADEGDCW
DAVLAFDPREMRALREQALLTARREPVLSRDRGHQRPRYPHVYDSYAEARQMAAFVGGAR
MLLPEGIHRDDTKLCEEVEIPPSQPMPVGLEENPVYISDLDQIGQLVFKGVKRLNRIQSI
VFETAYNTNENLLICAPTGAGKTNIAMLTVLHEIRQHLQPGGLIRKDEFKIVYVAPMKAL
AAEMTNYFSKRLEPLGIAVRELTGDMQLTKGEIQRTQMLVTTPEKWDVVTRKSVGDVALS
QMVRLLILDEVHLLHEDRGPVLESLVARTLRQVESTQSMIRILGLSATLPNYLDVATFLH
VNPYIGLFFFDGRFRPVPLGQTFVGVKTTNKVQQLHDMDEVCYNKVLEQVKAGHQVMVFV
HARNATVRTAMGLVEMAKNRGEACFFQPDQGPDYGQWDKTVVQRSRNKQMKEIFPEFGIH
HAGMLRSDRSLMESLFSRGHVKVLVCTATLAWGVNLPAHAVIIKGTEIYDAKRGALVDLG
ILDVMQIFGRAGRPQFDKCGQGTIITSHDKLSYYLTLLTQQNPIESQFLGSLADNLNAEV
ALGSVTNVEEAVKWLSYTYLYVRMRANPLAYGINHRVYQMDPALELYRKELVVETARKLD
KARMIRFQERTGYLASTDLGRTASHFYIRYNTMETFNENLNSQQTEAEILNTVSKAEEFE
QLKVRDEELEELDQLLSSYCLLPAAGGVENSYGKINILLQTYISRGEVDSFSLVSDLSYV
AQNAARIVRALFEMALRKRWPTLTYRLLTLCKVIDRRLWASAHPLRQFPSLSHVTLNRLE
EKRLSLERLKEMRKDEIGHMLHHVSVGSTVKQCLHQIPAVALEASVQPITRTVLRVRLLV
SPDFRWNDQVHGGVGEPWWLWVEDPLNDHIYHSEYLLLQKRQVVTGEAQNVVFTIPIFEP
LPSQYYIRVVSDRWLGAEAVCVINFQNLILPERHPPHTELLDLQPLPVTALGSHQFESLY
RFTHFNPIQTQIFHTLYHSDTNVLLGAPTGSGKTIAAELAMFRVFNQYPASKVVYIAPLK
ALVRERMEDWKVRMEEKLGKKVVELTGDVTPDMRAIAQADLIVTTPEKWDGVSRSWQNRS
YVQKVSILIIDEIHLLGEDRGPVLEVIVSRTNFISSHTSKAVRVVGLSTALANARDLADW
LGIKQVRWSLFNFRPSVRPVPLEVHIQGFPGQHYCPRMASMNKPTFQAIRSHSPAKPVLI
FVSSRRQTRLTALDLIAYLASEDNPKQWLHHQESQIEDVISTVRDSNLKLTLAFGIGMHH
AGLHERDRKVVEELFVNCKIQVLVATSTLAWGVNFPAHLVVVKGTEYYDGKSRRYVDYPI
TDVLQMMGRAGRPQFDDQGKAVILVDIKKDFYKKFLYEPFPVESSLLSVLSDHLNAEIAA
GTITSKQDAMDYITWTYFFRRLVMNPSYYSLEDISHESINRYLSSLVERSLRDLECSYCI
EIQEDERTIQPLTYGRISSYYYLKHQSIRTFKERLKPEMSVQELLTTLALLFSLLPVPLS
SSPSCFPPPPPSPFLLVFSPCSFLSLPVSSSCLPPPCISIPVSLSMYPYLCLTCLPHNVS
ISLSLSPCITLSVSSPVSHSCHHILLKWSHVRGRGKAGGFSGPIEELPELMDACQGDQSV
LAAIVGQELQPAQVAQVWSHLSLLPVLEVELSVKGWWEESQEQLERRLPPAGAHPREQSS
WLDVQADQEYVLQVALRRLHPGQQKSQRRDGRAQAPRFPKLKDEGWFLVLGEVEHRQLLA
LKRLGHVQARSSTALAFYTPERTGR
Download sequence
Identical sequences H3CHL6
ENSTNIP00000007744 ENSTNIP00000007744 99883.ENSTNIP00000007744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]