SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007952 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007952
Domain Number 1 Region: 185-244
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000454
Family UBA domain 0.00016
Further Details:      
 
Domain Number 2 Region: 801-877
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000611
Family Canonical RBD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007952   Gene: ENSTNIG00000005273   Transcript: ENSTNIT00000008113
Sequence length 977
Comment pep:known_by_projection chromosome:TETRAODON8:3:9055234:9061895:-1 gene:ENSTNIG00000005273 transcript:ENSTNIT00000008113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSAWGDPGTYNKAVNLWDRNNSGMSQTKVNTGGNNPQGSNNNNHHPPSHHQSGPSHSRGP
LAAQGHSGWGEIPSSHTKSESSWGDPAPSPVTVDNGTSAWGKPTGGCSSWGDSNPGMAPT
SCKPAPKPMQDGWGGGGDEMNLSGGQWDAEDGDMWNSAASQESNSSCNSWGNASKKIAQK
GKVPGKQEDTWIMNRLIKQLTDMGFPRDPAEEALKSNNMNLDQAMSALLEKKTELDKRGM
AITGHDYNSGLINKPMNCPRPPLLSKDPSADPRLPFMDKTAAQDIISFSLARYIKSYITI
FIISQVIYFNFLLITRFFSIQQMQSGMFGGGGAEQVRAVQQAQSLQPPVPLFNFSQPSLR
VQVTQFFSLQVQAQLLQFAAKNIGLNPALLTTPINPQHMTLLNQLYQLQLAYQRLQIQQQ
MLQAQRNVSGPIRQQEQQVARTISNMQQQIQQHQRQLAQALLMKQQQQQPPPSHSGLHPS
GAKSTLDSFPGHPQAPGFPDMQTKEPQSSPNTYSSYSLAGMNPNMNVNCMEVGGLAMKEP
PQPQSRLSQWTHPHSMESLSGNSSPLEPNLGKHGANLCPPGKPHQLEDSYSPYSLMPSSD
SPSSPLVPPDNWGQGKSSSDKMANGTNINWPPEFCPGVPWKGLQNIDPETDPNVTPGSVP
SGPTINTTIQDVNRYLLRDRSGGSSPTPSQSEAQPPSTDWPVSGYSSSFSMSSPETDDAG
KLSEMKSTWSPGPISHSQASLSHDLWKVPQAPRSANTAPSRPPPGLTNTKPASTWGGTSL
GLAQGWSSSYTTAGTTWSTDSSTRTSSWLVLRNLTPQIDGSTLRTLCMQHGPLITFHLNL
TQGSAVVRYSSKDEAAKAQKSLHMCVLGNTTILAEFAGEEEVNRFFAQGQLLGGTTSWQA
TPGTNQTRMGGASSGAAHPIGHSSHWTAKTGGELLWGGVQQYSSLWRPPSAEEGRVMGSP
TPINTLLPGDLLSGESM
Download sequence
Identical sequences H3CI74
ENSTNIP00000007952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]