SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007984 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007984
Domain Number 1 Region: 146-454
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-93
Family Protein kinases, catalytic subunit 0.000000000127
Further Details:      
 
Domain Number 2 Region: 1-111
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-22
Family Pleckstrin-homology domain (PH domain) 0.00000443
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007984   Gene: ENSTNIG00000005303   Transcript: ENSTNIT00000008145
Sequence length 482
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:28271333:28274518:-1 gene:ENSTNIG00000005303 transcript:ENSTNIT00000008145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDQNVVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKDKPQDSDLAYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPDERDEWAEAIQMVADSLAKQEEEGILSS
PTSQIENVNEEEMDTSISHYKRKVQTMNDFDYLKLLGKGTFGKVILVKEKASGTYYAMKI
LKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTDRLCFVMEYVNGGELFFHLSR
ERVFSEDRTRFYGAEIVSALDYLHSAKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITD
TATMKTFCGTPEYLAPERQVLEDNDYGRGVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIKFPRTLSADAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSTIDWQDLYDKK
LVPPFQPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDAADNERRPHFPQFSYSASG
RE
Download sequence
Identical sequences H3CIA6
ENSTNIP00000007984 ENSTNIP00000007984 99883.ENSTNIP00000007984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]