SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008784 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008784
Domain Number 1 Region: 375-483
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 8.37e-26
Family FAD-dependent thiol oxidase 0.0044
Further Details:      
 
Domain Number 2 Region: 8-118
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.88e-17
Family PDI-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008784   Gene: ENSTNIG00000006041   Transcript: ENSTNIT00000008954
Sequence length 614
Comment pep:known_by_projection chromosome:TETRAODON8:12:12485847:12490006:-1 gene:ENSTNIG00000006041 transcript:ENSTNIT00000008954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASLYTDEDPLVILSSGSLRSSVTNSSSAWLLQFFSSWCGHCIQYSSTWKVLAEDVKDWQ
AVIAVSVLDCAQEENHEICREFGIQLFPTIKFFHAHSPETDRGTPFRGANRQVQTVRQVM
VDILQNHTKLDWPDRCPRLEPYSSEDLLPRLGQRSEDYTAIVVEEPDSYVGREVILDLLM
FSGVQVKRALSSERPLVEALGVTSFPSLYLLHPNSTHTEPRVEKKQRFFFSSFLKTLPGV
QRKAGGRSSAAGLQEAAPGRGASESWRRFDSAKVYTADLESGLHYLLRVELASHDYLEGE
ELSIFKDFVTLVAKLYPGGGSVVRLMEALSDWLLSLQGRRLVYQNVLDLVDNKMRVRQCV
PGGGVRWVGCQGSRAGLRGYPCSLWTLFHILTVQHAAKPTALENTGGSREAAPVLQVMRR
YIRTFFGCQECGRHFEQAAAAGLDQVQNPDQQILWLWEQHNRVNSRLSGTLSDDPLFPKA
PWPGPALCATCHEEKNGARWNRDNVLVFLRRHYGASNLSHRHAISPPGPAQLRPAGQEQN
QEQQPDSGPGPQSGQQEAAGPGGGLWVLGLGFSATDMSLCVLLYVCSCLVLMLLFFFFKV
KSKRWRRRKSPLQV
Download sequence
Identical sequences H3CKK5
ENSTNIP00000008784 ENSTNIP00000008784 99883.ENSTNIP00000008784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]