SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009489 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009489
Domain Number 1 Region: 237-375
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.45e-27
Family UBX domain 0.02
Further Details:      
 
Domain Number 2 Region: 3-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000374
Family Thioltransferase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009489   Gene: ENSTNIG00000006705   Transcript: ENSTNIT00000009663
Sequence length 490
Comment pep:known_by_projection chromosome:TETRAODON8:2:9404031:9408729:-1 gene:ENSTNIG00000006705 transcript:ENSTNIT00000009663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIWFGGSIPEAIKAAKQQSRIFVVVITGEDDQSTQLMSSWDDGRVVKETLECCVAIKIDA
KSDMCIKFSEIYPVVCVPSTFFIGDNGIPLEVIAGSVSADELMGRINRVKQMHGQAGAPV
QSGPREAAGGAPASEAALTLGSSTTEPAAAAPTARASSSRTEEQTPTEIGPPDHPAQSSQ
AAHNLHTTRESSAKNLEQRPTLKKSEDEKEVRQERRTAGRDSQEEKTKRLLEERNREKEE
EKAARERIKQQIAMDRAERAARYAQSQEEERAAKQASLQARQAEEEHRKEATLRERSTIV
RIQFRLPDGSSFTSQFPLQGRLQEARQFVVQEVGNCYGNFSMATMFPRRVFTAEDMSRTL
VELELAPSASIVILPSSWQRGAVVQSSGGGVWTVLSTLLYPLLAVWRFLSSFVFASPPSR
ESASRGQNHSQSNAHTSLGPDKAKREKQPTQTAEKRPKEFKKDGNICRLRTQEDSEEDNN
TWNGNSTQQM
Download sequence
Identical sequences H3CMK8
ENSTNIP00000009489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]