SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009595 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009595
Domain Number 1 Region: 17-174
Classification Level Classification E-value
Superfamily C-type lectin-like 6.82e-28
Family C-type lectin domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009595   Gene: ENSTNIG00000006804   Transcript: ENSTNIT00000009770
Sequence length 257
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:88246114:88247408:1 gene:ENSTNIG00000006804 transcript:ENSTNIT00000009770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCLPGQTVCLGDPQRPCYKIAYFQEVWSRVAFREASEACRMDGGSLLSIQSPGEQKDIEN
LLQEMRSGAVGGAGAAGGIADGDYWIGLVRVDDHAPAEAGSTSHSCSDLYRWTDGSPASF
RNWYFDEPSCGGEACVVMYHQPAALPGLGGAYLYQWNDDRCNMKHNFICKYHPEATAGGG
GVKPSTEDVPSQVTTAGSSGMLLLSVILPTIPLFLLILVASGTCCFQLLKRSSRAKTEVH
QPNLWISESPGGDTVEA
Download sequence
Identical sequences H3CMW4
ENSTNIP00000009595 99883.ENSTNIP00000009595 ENSTNIP00000009595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]