SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010002 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010002
Domain Number 1 Region: 160-274
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-35
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 2 Region: 37-148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-35
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 3 Region: 357-479
Classification Level Classification E-value
Superfamily TIMP-like 1.32e-30
Family Netrin-like domain (NTR/C345C module) 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010002   Gene: ENSTNIG00000007199   Transcript: ENSTNIT00000010181
Sequence length 479
Comment pep:known_by_projection chromosome:TETRAODON8:20:804053:807922:-1 gene:ENSTNIG00000007199 transcript:ENSTNIT00000010181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EASGMEGRVWTLCVLVALRLGCTEAQAQSNYSRPTFECGGHLVTDSGIVASEGFPTPYKP
NSKCTWYITVPEGHVVMMSFRLFDLEADPTCRYDYLDIYNGHSRLVQKLGRFCGTFRPGA
LISTSNTMMLEMVSDEATGGRGFLAYFNAGKPHMEEDQFCGGRLTKTHGSVKTPNWPNSN
YPAGISCSWHISVPPSNVIEVKFEKLDLEPDTYCRYDYVALFNGGETDNSRRIGKFCGDR
APGVIVTNGNELLVQFVSDLSITSDGFLAHYSSVPRGTRTPTSTGDFIYGPQTTSIPQKP
SKPVKPSPKLKPKPAPKPTKKPPVKTPLKPPPRKPAAKPVKPTAKPKPAKPTRAAPANPL
CTQPCKRTGTLQSSYCPHDFVITGKVTAVLPGPSSAKVEVSLIKNYKPGRLSVTKSGPAT
SVTLTSTCKRCPGLTKGLNYVLMGGVDAQGNGVLTPASFTLLYKPVHAKALAALSRKAC
Download sequence
Identical sequences H3CP19
99883.ENSTNIP00000010002 ENSTNIP00000010002 ENSTNIP00000010002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]