SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010691 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010691
Domain Number 1 Region: 513-558
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000288
Family TSP-1 type 1 repeat 0.00091
Further Details:      
 
Domain Number 2 Region: 67-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000139
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 13-60
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000126
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000010691
Domain Number - Region: 467-506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000313
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010691   Gene: ENSTNIG00000007871   Transcript: ENSTNIT00000010872
Sequence length 558
Comment pep:known_by_projection chromosome:TETRAODON8:15:2855975:2858936:1 gene:ENSTNIG00000007871 transcript:ENSTNIT00000010872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRKIRAVNRPIPVNCQLGRWSTWTPCNSCTDKKFRFRYLEKPAQFGGTDCLEKLWDSLVC
PTATEKCMVPDYCGDSFTCKETGRCISQSLRCNGEPDCDDFSDEDGCENVNRREDKCSTI
MSIPGAERGTQGYNILTGEFVDPVLDSKYFGGKCEYVYNGEWRKFIYDSFCENLQYREDE
KNYRKPYNYHTYRFVAEATSEGSQEYYEDVVSLLRARKDSKSSSGGFTVGIYYVEAGLGG
SQESEFFHNVTHYKSTDLGFVRLWSKVETAHFKMRSDKLMLHEDFYISLMDLPEQYDFGM
YSRFFNTYGTHYVTQGTMGGTLEYALVLNKTKMAESKLQGEQAGRCFSASIGLSYPIGQG
ASVDLKLGVNPCSKDGTFNQGSDASSVMVEDIITLVKGGILDSTSGVMVVRNPETYRTWG
ASLKYNPTLIEHEIMPIYELVRFSTAADHVGARLANLRRAWDEYMQQFDPCRCAPCRHNG
LPVLTGTSCKCLCKSGYQGEACEETLRRAAKTDGSWSCWGSWSSCSSGRKTRGRSCSNPA
PDGGGAACRGSSSQTQRC
Download sequence
Identical sequences H3CR07
ENSTNIP00000010691 99883.ENSTNIP00000010691 ENSTNIP00000010691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]