SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011094 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011094
Domain Number 1 Region: 1-286
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.98e-73
Family FCH domain 0.0000000278
Further Details:      
 
Domain Number 2 Region: 462-517
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000315
Family SH3-domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011094
Domain Number - Region: 335-407
Classification Level Classification E-value
Superfamily t-snare proteins 0.00133
Family t-snare proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011094   Gene: ENSTNIG00000008264   Transcript: ENSTNIT00000011276
Sequence length 526
Comment pep:known_by_projection chromosome:TETRAODON8:18:9576612:9586077:-1 gene:ENSTNIG00000008264 transcript:ENSTNIT00000011276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWGTDLWDQYDQIEKHTQSGIDLLELYIKFVKERTEIEQGYAKQLRNLTKKYAKRGSKD
ELDCKFSNQASFQDILNELNDYAGQRELVAENMMKGICAELSKYLQDLKQERKGHLSDAK
KAQQNLESSFKQLESTKKRFAKEWAEAEKATQHAEKIEHESGSTKLDVEKAKQQAHNRMH
VAEESRNDYAAQLQKYNKDQNYFYYTETPQIFNKMQEMDEQRIRHLAEGYCQFSDIEKKV
LPIISKCLEGIAAAGNKINEKQDSMLFIEQHKSGFERPADVEFEDYTQGIKAATSDSSLN
PPKGRPKRWLFGKKNKLPPAEDFSHLPPEQRKKKLQAKIDDINKELQKTQDQSEALEKMK
GVYGQNPQLGDPSSLEPQISETAQHIGRLRGELAKHETWLSEAVGGEESANLINNNAQHV
TCRTVNVRDEIPFLNVVFSRAAPYQTHNLYTEFDDEFEDVEPPLGQCTVLYNFEGNSEGT
ISIKEGELLSIMEEDKGDGWMRVQRGSGEEGFIPSSYQSVTLKEAF
Download sequence
Identical sequences H3CS60
ENSTNIP00000011094 ENSTNIP00000011094 99883.ENSTNIP00000011094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]