SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011096 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011096
Domain Number 1 Region: 193-392
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-51
Family DBL homology domain (DH-domain) 0.00000015
Further Details:      
 
Domain Number 2 Region: 2-233
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.24e-39
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Domain Number 3 Region: 380-543
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-29
Family Pleckstrin-homology domain (PH domain) 0.0077
Further Details:      
 
Domain Number 4 Region: 639-757
Classification Level Classification E-value
Superfamily SH2 domain 1.94e-24
Family SH2 domain 0.00076
Further Details:      
 
Domain Number 5 Region: 775-845
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-21
Family SH3-domain 0.00079
Further Details:      
 
Domain Number 6 Region: 591-661
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000108
Family SH3-domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011096   Gene: ENSTNIG00000008266   Transcript: ENSTNIT00000011278
Sequence length 851
Comment pep:known_by_projection chromosome:TETRAODON8:18:9559706:9567260:-1 gene:ENSTNIG00000008266 transcript:ENSTNIT00000011278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCAAWLIDCRVLPDNHRVTWQSAQVCDLAQALRDGVLLCQLLNNLLPQAVNLREI
NLRPQMSQFLCLKNIRTFLAACQTKFYLKKSELFEAFDLFDVRDFGKVIDTLSTLSRSHI
ATQRGFQPFPLEGSTLDDEIYSGLSDQIDDTLDEDVDLYDFVEDEEDIGDEIYEDLMKTE
EHPERQQQKYGVDKRECCLQEIRQTEEKYSETLESVIQHFMKPLERFLQPQDIESIFINI
EDLAVIHRNLLGDVRTSILNCGAKNLHQVFLDYKERLLLYGSYCSQVETATKHLDKISGQ
REDIRMKLEECSNRANSGRFSLRDLLMVPMQRVLKYHLLLQELVKHTTDLKDKENLRMAL
DAMRDLAQCVNEVKRDNEVIKQITTFQLSIENLAHSLALYGRPKIDGELKMCTPEKKSKH
DRFAFLFDKAMFVCKKKSGETFELKEIIELQSYHIRDEPSGEKDNKKWSHVFLLLDGYGG
AGYDLYFKTRELKKKWLEQFEMALSNLCPENATANSHDFQMHCFEGTASCRACSMLLRGI
FFQGYRCTRCKMAAHKECLGRVDACGRNSAEFTGSPKAANSHICCSVFYRIHCMLGFPKM
EVCQDYFGMPPPPVGFGQPLLLSKGDIVELTRADTDLSWWEGRNLCLGNIGWFPCQKVQP
YVPRPTPDLSGFPWFAGNMDRTAAKNLLTPRSDGTFLVRQKEGGEFAISIKFNIDIRHIK
ITTSDGLFRINDKKAFRGLIELIEFYQQHSLKEYFREVDTMLCTPFKQSEESNSTSSTPD
TTPRGSVKGVSVARARYNFSARDRSELSLQEGDTIKILSKKGHTGWWKGEVYGRVGLFPA
NYVDEDYSEYC
Download sequence
Identical sequences H3CS62
ENSTNIP00000011096 ENSTNIP00000011096 99883.ENSTNIP00000011096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]