SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011216 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011216
Domain Number 1 Region: 173-249
Classification Level Classification E-value
Superfamily Homeodomain-like 5.99e-19
Family Homeodomain 0.0000654
Further Details:      
 
Domain Number 2 Region: 54-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000147
Family LIM domain 0.017
Further Details:      
 
Domain Number 3 Region: 22-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000118
Family LIM domain 0.023
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011216
Domain Number - Region: 117-143
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.025
Family LIM domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011216   Gene: ENSTNIG00000008382   Transcript: ENSTNIT00000011398
Sequence length 360
Comment pep:known_by_projection chromosome:TETRAODON8:13:7262838:7265589:-1 gene:ENSTNIG00000008382 transcript:ENSTNIT00000011398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDILLNTSFLDDMGDHSKKKSGIAMCVGCGSQIHDQYIMRVSPDLEWHAACLKCAECSQ
YLDETCTCFVRDGKTYCKRDYARIFGIKCAKCNVGFCSSDLVMRARDNVYHMECFRCSVC
CRHLLPGDEFSLREDELLCRADHCLLMERASAGSPLSPGPIHSRPLHISDAVSVRHPPHH
RNHVHKQSEKTTRIRTVLTEKQLHTLRTCYNANPRPDALMKEQLVEMTGLSPRVVRVWFQ
NKRCKDKKRSIMMKQLQQQQQHSDKTNLQGLTGTAMVAGSPIRHENTVQGNPVEVQTYQP
PWKSLSDFALQSDLEQPAFQQLVSFSESGSLGNSSASDVTSLSSQLPDTPNSMVHSPIDT
Download sequence
Identical sequences Q4SM40
ENSTNIP00000011216 ENSTNIP00000011216 99883.ENSTNIP00000011216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]