SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011222 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011222
Domain Number 1 Region: 491-655
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 2.62e-66
Family A middle domain of Talin 1 0.000000478
Further Details:      
 
Domain Number 2 Region: 754-890
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.18e-54
Family I/LWEQ domain 0.00000227
Further Details:      
 
Domain Number 3 Region: 662-784
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.22e-47
Family I/LWEQ domain 0.00000607
Further Details:      
 
Domain Number 4 Region: 1839-1973
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.35e-46
Family VBS domain 0.00000908
Further Details:      
 
Domain Number 5 Region: 1226-1362
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 7.85e-43
Family VBS domain 0.019
Further Details:      
 
Domain Number 6 Region: 198-312
Classification Level Classification E-value
Superfamily Second domain of FERM 7.07e-31
Family Second domain of FERM 0.00000135
Further Details:      
 
Domain Number 7 Region: 1074-1208
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.37e-28
Family VBS domain 0.0089
Further Details:      
 
Domain Number 8 Region: 313-403
Classification Level Classification E-value
Superfamily PH domain-like 5.16e-24
Family Third domain of FERM 0.0000178
Further Details:      
 
Domain Number 9 Region: 1470-1556
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000124
Family I/LWEQ domain 0.0081
Further Details:      
 
Domain Number 10 Region: 1695-1815
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000251
Family VBS domain 0.038
Further Details:      
 
Domain Number 11 Region: 2004-2133
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000534
Family VBS domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011222
Domain Number - Region: 1583-1660
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000173
Family VBS domain 0.057
Further Details:      
 
Domain Number - Region: 81-136
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000195
Family Ras-binding domain, RBD 0.086
Further Details:      
 
Domain Number - Region: 946-1043
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00824
Family I/LWEQ domain 0.0042
Further Details:      
 
Domain Number - Region: 2107-2228
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0432
Family I/LWEQ domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011222   Gene: ENSTNIG00000008387   Transcript: ENSTNIT00000011404
Sequence length 2333
Comment pep:known_by_projection chromosome:TETRAODON8:13:7313092:7353029:-1 gene:ENSTNIG00000008387 transcript:ENSTNIT00000011404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKICVRQCNVVKTMQFEPSTPVYDACRIIRERVPEAQTGQASDYGLFLSDDDPRK
GIWLESGRTLDYYMLRNGDVLEYKKKQRPQKIKMLDCAIKTIMVDDSKTVGELLVTICSR
IGITNYEEYSLIQEVTEDKKEDGMGTLKKDRTLLLRDERKMEKLKAKLHTDDDLNWLDHS
RTFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACE
FAGIQAQIQFGPHVEHKHKPGFLDLKEFLPKEYTKQRGSEKKIFQDHKNCGEMTEIEAKV
KYVKLARSLQTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKDVVQEWPLTTV
KRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEE
ATMLEESVSPKKSTILQQQFNQTGRGLHRSAAGGFVLESRRPRPYNMGTMPSAQQQVTTG
QMHRGHMPPLSLAQQALMGTINSSMQAVQQAQADLGYADNPPPLGHDLASRAWVQNKVDE
SKHEIHSQVGAITAGTASVVNLTAGEPTETDYSAVGCAITTISSNLTEMSKGVKLLSALM
DDDVGSGHKLMGAARMLAGAVSDLLRSVEPAAAEPRQTVLTAAGSIGQASGDLLRHMGEG
EIDEKFQETLMNLAKAVANAAAMLVLKAKNVAQVAEDTVLQNQVIAAATQCALSTSQLVA
CTKVVSPTISSPVCQEQLVEAGKLVDRSVETCVKACRSASDDGELLKQVSAAAGVVGQAL
SDLLQHVRHYASCGEPIGRYDQATDTIMNVTENIFTSMGDAGEMVRQARVLAQATSDLVN
AMRSDAEAEIDVDNSKKLLAAAKLLADATARMVEAAKGAAANPENEDQQQRLREAAEGLR
VATNAAAQNAIKKKLVNRLELAAKQAAAAATQTIAAAQNAAASNKNTVAHQHLVHSCKAV
ADSIPQLVQGMRSSQAQPEELGAQLALIMASQSFLQPGSKMVTSAKSAVPTVADQAAAMQ
LGQCAKNLATCLAELRTATQKAHEACGPLEIDSALKTVQTLKSELQDAKMSVIDSQLKPL
PGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQALRTLAQAARGVA
ASTKEPQAAAAMLDSAQYVMEGSAMLIHEAHQALVHPGDAESQQRLAQVAKAVSHSLNNC
VNCLPGQKDVDMALRSIGEASKKLLVDILPPCSKTFQEAQTDLNHTAAELNHSAGEVVHS
SRGTSGQLAAASRKFSQDFDEFLDAGIEMAGHTQSKDDQIQVIGNLKNISMASSKLLLAA
KSLSVDPGAANAKNLLAVAARAVTESINQLITLCTQQAAGQKECDNALRELEAVRGLLEN
RNEPVNELSYFDCIESVMENSKVLGEAMAGISQHCKTGDVAAFGDSVGVASKALCGLTEA
AGQASYLVGVSDPNSQSGYEGLVDPIQFAKAHQAIQMACQNLVDPASSPSQVLSAATIVA
KHTSALCNACRLASSKTSNPVARRQFVQSAKEVANTTANLVKTIKGSDEDFSEENRNRCR
VATTPLLEAVENLSTFANNPEFASIPAQISNEGSAAQEPIVRSARAMLDSSTYLLETARS
LVLNPKDPPTWSILAGHSRTVSDSIKSLITSIRDKAPGQRECDYSIDNINKCIRDIEQAS
LAAVGQTLPCRDDISMEALQEHLTSSVQEIGHLIDPVSTAARGEAAQLGHKVTQLASYFE
PLIVASVGLASKLHDHQQQMTILDQSKTLAESALQMLYAAKEGGGNPKASHTHDAIAEAA
QLMKEAVDDIMVTLNEAASEVGLVGGMVESIAEAMGRVDEGTPPEPEGSFVDYQTTMVKF
SKAIAITAQEMMTKSVTCPEELGGLASQVTVDYVQLAHQGRLAAATAESEEVGFQIKTRV
QELGHGCIYMVQKAGALQLSPTDSFSKRELIECARAVMEKVSLVLSALQAGNKGTQACIT
AASAVSGIIADLDTTIMFASAGTLNPENEDSFADHRESILKTAKALVEDTKLLVAGAASS
QEKLAQAAHSSAKTITQLTEVVKLGATSMGSEGPETQVVLINAVRDVAKALAELIGATKC
AAGKAADDLSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTLF
QSKDVPEKSTTPEEFTRMTKGITTATAKAVAAGNSAQQEDVIATANLSRKAISEMLATCK
QAAYHPEVSEELRNKALQYSSECTTGYISLLEQVLQVLQKPTAEQKQQLAVHSKHVAACV
TELIQTAEAMKGSECVDPQDPTVIAETELLGAATSIEAAAKKLEQLKPRAKPK
Download sequence
Identical sequences H3CSI8
ENSTNIP00000011222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]