SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011223 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011223
Domain Number 1 Region: 492-656
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 2.62e-66
Family A middle domain of Talin 1 0.000000478
Further Details:      
 
Domain Number 2 Region: 755-891
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.18e-54
Family I/LWEQ domain 0.00000227
Further Details:      
 
Domain Number 3 Region: 663-785
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.22e-47
Family I/LWEQ domain 0.00000607
Further Details:      
 
Domain Number 4 Region: 1841-1975
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.35e-46
Family VBS domain 0.00000908
Further Details:      
 
Domain Number 5 Region: 1227-1363
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 7.85e-43
Family VBS domain 0.019
Further Details:      
 
Domain Number 6 Region: 198-312
Classification Level Classification E-value
Superfamily Second domain of FERM 7.07e-31
Family Second domain of FERM 0.00000135
Further Details:      
 
Domain Number 7 Region: 1075-1209
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.37e-28
Family VBS domain 0.0089
Further Details:      
 
Domain Number 8 Region: 313-403
Classification Level Classification E-value
Superfamily PH domain-like 5.16e-24
Family Third domain of FERM 0.0000178
Further Details:      
 
Domain Number 9 Region: 1471-1557
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000124
Family I/LWEQ domain 0.0081
Further Details:      
 
Domain Number 10 Region: 2006-2135
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000534
Family VBS domain 0.022
Further Details:      
 
Domain Number 11 Region: 1696-1816
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000022
Family VBS domain 0.041
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011223
Domain Number - Region: 1584-1661
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000173
Family VBS domain 0.057
Further Details:      
 
Domain Number - Region: 81-136
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000195
Family Ras-binding domain, RBD 0.086
Further Details:      
 
Domain Number - Region: 947-1044
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00824
Family I/LWEQ domain 0.0042
Further Details:      
 
Domain Number - Region: 2109-2230
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0432
Family I/LWEQ domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011223   Gene: ENSTNIG00000008387   Transcript: ENSTNIT00000011405
Sequence length 2335
Comment pep:known_by_projection chromosome:TETRAODON8:13:7313092:7353029:-1 gene:ENSTNIG00000008387 transcript:ENSTNIT00000011405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKICVRQCNVVKTMQFEPSTPVYDACRIIRERVPEAQTGQASDYGLFLSDDDPRK
GIWLESGRTLDYYMLRNGDVLEYKKKQRPQKIKMLDCAIKTIMVDDSKTVGELLVTICSR
IGITNYEEYSLIQEVTEDKKEDGMGTLKKDRTLLLRDERKMEKLKAKLHTDDDLNWLDHS
RTFREQGVEESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACE
FAGIQAQIQFGPHVEHKHKPGFLDLKEFLPKEYTKQRGSEKKIFQDHKNCGEMTEIEAKV
KYVKLARSLQTYGVSFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKDVVQEWPLTTV
KRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEE
ATMLEESVSPKKSTILQQQFNTREKLEGTSVTLPGRVLESRRPRPYNMGTMPSAQQQVTT
GQMHRGHMPPLSLAQQALMGTINSSMQAVQQAQADLGYADNPPPLGHDLASRAWVQNKVD
ESKHEIHSQVGAITAGTASVVNLTAGEPTETDYSAVGCAITTISSNLTEMSKGVKLLSAL
MDDDVGSGHKLMGAARMLAGAVSDLLRSVEPAAAEPRQTVLTAAGSIGQASGDLLRHMGE
GEIDEKFQETLMNLAKAVANAAAMLVLKAKNVAQVAEDTVLQNQVIAAATQCALSTSQLV
ACTKVVSPTISSPVCQEQLVEAGKLVDRSVETCVKACRSASDDGELLKQVSAAAGVVGQA
LSDLLQHVRHYASCGEPIGRYDQATDTIMNVTENIFTSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEAEIDVDNSKKLLAAAKLLADATARMVEAAKGAAANPENEDQQQRLREAAEGL
RVATNAAAQNAIKKKLVNRLELAAKQAAAAATQTIAAAQNAAASNKNTVAHQHLVHSCKA
VADSIPQLVQGMRSSQAQPEELGAQLALIMASQSFLQPGSKMVTSAKSAVPTVADQAAAM
QLGQCAKNLATCLAELRTATQKAHEACGPLEIDSALKTVQTLKSELQDAKMSVIDSQLKP
LPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQALRTLAQAARGV
AASTKEPQAAAAMLDSAQYVMEGSAMLIHEAHQALVHPGDAESQQRLAQVAKAVSHSLNN
CVNCLPGQKDVDMALRSIGEASKKLLVDILPPCSKTFQEAQTDLNHTAAELNHSAGEVVH
SSRGTSGQLAAASRKFSQDFDEFLDAGIEMAGHTQSKDDQIQVIGNLKNISMASSKLLLA
AKSLSVDPGAANAKNLLAVAARAVTESINQLITLCTQQAAGQKECDNALRELEAVRGLLE
NRNEPVNELSYFDCIESVMENSKVLGEAMAGISQHCKTGDVAAFGDSVGVASKALCGLTE
AAGQASYLVGVSDPNSQSGYEGLVDPIQFAKAHQAIQMACQNLVDPASSPSQVLSAATIV
AKHTSALCNACRLASSKTSNPVARRQFVQSAKEVANTTANLVKTIKGSDEDFSEENRNRC
RVATTPLLEAVENLSTFANNPEFASIPAQISNEGSAAQEPIVRSARAMLDSSTYLLETAR
SLVLNPKDPPTWSILAGHSRTVSDSIKSLITSIRDKAPGQRECDYSIDNINKCIRDIEQA
SLAAVGQTLPCRDDISMEALQEHLTSSVQEIGHLIDPVSTAARGEAAQLGHKVTQLASYF
EPLIVASVGLASKLHDHQQQMTILDQSKTLAESALQMLYAAKEGGGNPKKASHTHDAIAE
AAQLMKEAVDDIMVTLNEAASEVGLVGGMVESIAEAMGRVDEGTPPEPEGSFVDYQTTMV
KFSKAIAITAQEMMTKSVTCPEELGGLASQVTVDYVQLAHQGRLAAATAESEEVGFQIKT
RVQELGHGCIYMVQKAGALQLSPTDSFSKRELIECARAVMEKVSLVLSALQAGNKGTQAC
ITAASAVSGIIADLDTTIMFASAGTLNPENEDSFADHRESILKTAKALVEDTKLLVAGAA
SSQEKLAQAAHSSAKTITQLTEVVKLGATSMGSEGPETQVVLINAVRDVAKALAELIGAT
KCAAGKAADDLSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELT
LFQSKDVPEKSTTPEEFTRMTKGITTATAKAVAAGNSAQQEDVIATANLSRKAISEMLAT
CKQAAYHPEVSEELRNKALQYSSECTTGYISLLEQVLQVLQKPTAEQKQQLAVHSKHVAA
CVTELIQTAEAMKGSECVDPQDPTVIAETELLGAATSIEAAAKKLEQLKPRAKPK
Download sequence
Identical sequences H3CSI9
ENSTNIP00000011222 ENSTNIP00000011223 99883.ENSTNIP00000011223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]