SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011231 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011231
Domain Number 1 Region: 4-42
Classification Level Classification E-value
Superfamily UBA-like 0.000074
Family TAP-C domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011231   Gene: ENSTNIG00000008396   Transcript: ENSTNIT00000011413
Sequence length 534
Comment pep:known_by_projection chromosome:TETRAODON8:13:7678787:7690777:1 gene:ENSTNIG00000008396 transcript:ENSTNIT00000011413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDLSAALNDYEELRQVHTANLPQVFNEGR
YYRPPETRDTPTHVSKIDRPCAQKQEDNAQEKRLSRGISHASSAIVSLARLQVASECTNE
QFPLEMPIYTFQLPDLSVYSEDFRSFIERDLIEQSTMMALEQAGRLNWWSTMCISCKKLL
PLATTGDGNCLLHAASLGMWGFHDRDLMLRKSLYTMMKSGAERDALKRRWRWQQTQQNKE
SGLVYTEEEWEKEWNELLKLASSEPRTHLSKNGTTSGGVDNTEDPVYESLEEFHVFVLAH
VLRRPIVVVADTMLRDSGGEAFAPIPLGGLYLPLEVPPSRCHCSPLVLAYDQAHFSALVS
MEQRDQQREQAVIPLTDSEHKLLALHFAVDPGRDWEWGRDDNDNTKLANLILSLEAKLNL
LHNYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLAESMDSDRESVGSNSNVNSANKL
GSFSKTLGIKLKKNMGGLGGLVHGKMNKSNSGSGRSGENGGEKIKKKESKATKG
Download sequence
Identical sequences H3CSJ7
ENSTNIP00000011231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]