SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011431 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011431
Domain Number 1 Region: 148-463
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-100
Family Protein kinases, catalytic subunit 0.0000000000478
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-23
Family Pleckstrin-homology domain (PH domain) 0.00000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011431   Gene: ENSTNIG00000008591   Transcript: ENSTNIT00000011613
Sequence length 482
Comment pep:known_by_projection chromosome:TETRAODON8:7:2113342:2117049:-1 gene:ENSTNIG00000008591 transcript:ENSTNIT00000011613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVNIVKEGWLQKRGEYIKTWRPRYFILKSDGSFIGYKEKPDLNDQTSPPLNNFSVAGQ
SSIETKLKDPRPNTFVIRCLQWTTVIERNFHVDSNEDREEWMWAIQSVANSLKMREQDEE
EPMDLLGSPNESSLEEMEVATSKRCTRVTMNDFEYLKLLGKGTFGKVILVKEKATGVHYA
MKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTNDRLCFVMEYANGGELFF
HMSRERVFTEDRARFYGAEIVSALEYLHSRDVVYRDLKLENLMLDKDGHIKITDFGLCKE
GITPDATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLF
ELILMEDIRFPRNLSPEAKSLLAGLLKKDPKQRLGGGPDDAKEVMTHKFFTNINWQDVVQ
KKLTPLFKPQVTSETDTRYFDEEFTAQTITLTPPDKYTSLDSEDPSQQAHFPQFSYSASI
RE
Download sequence
Identical sequences H3CT47
ENSTNIP00000011431 99883.ENSTNIP00000011431 ENSTNIP00000011431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]