SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011571 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011571
Domain Number 1 Region: 249-401
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.12e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000000588
Further Details:      
 
Domain Number 2 Region: 404-561
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000000713
Further Details:      
 
Domain Number 3 Region: 618-780
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.06e-36
Family MAM domain 0.0017
Further Details:      
 
Domain Number 4 Region: 12-117
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-33
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 
Domain Number 5 Region: 122-240
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-30
Family Spermadhesin, CUB domain 0.00000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011571   Gene: ENSTNIG00000008719   Transcript: ENSTNIT00000011753
Sequence length 900
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:89954312:89997086:-1 gene:ENSTNIG00000008719 transcript:ENSTNIT00000011753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKCGGNIRISSASYLTSPGYPLSYSPSQRCTWVISAPGPHQRILINFNPHFDLEDRECKY
DYVEVRDGVDESGQLVGKYCGKIAPSPVVSSGNQLFIKFVSDYETHGAGFSIRYEIFKTG
PECSRNFTSNSGVIKSPGFPEKYPNNLDCTFMIFAPKMSEIILEFESFELEPDQTPPAGV
FCRYDRLEIWDGFPGVGPYIGRYCGQNTPGRIISYTGILALTINTDSAIAKEGFSANFTV
IERTVPEDFDCSDPLGMESGEIASEQIMASSQYNPSWSPERSRLNYYENAWTPAEDSNKE
WIQVDLGFLRFVSAIGTQGAISQETQRIYFVKSYKVDVSSNGEDWITLKEGSKQKIFQGN
TNPTDVAKTMLPKPTLTRFVRIRPVTWETGIALRFEVYGCKISEYPCSGMLGMISGLITD
NQITASSHTDRNWVPENARLLTSRTGWTLLPQPQPFASEWLQIDLGEEKLVKGLIIQGGK
HRENKVFMKKFRLGYSNNGSEWTMVFDTNGNKPKIFEGNGNYDTPELRIVEPLLTRFIRI
YPERATPAGMGLRLELLGCEIEAPTLPPTTAVPSTTPTDECDDDQASCHSGTGDDYDVTG
ANIALMRLRASPLPPFQWFACDFGWASDPSFCSWTSEDTGSRWQIQSSGTPTLNTGPNMD
HTGGSGNFIYTLATGPQETKVARLVSPMVTSPDSDLCVSFWYHMFGSHIGTLHIKQRKQT
ADGPADILLWTVSGHQGSRWREGRVLVPQTNKPYQVVIESLMDAKSWGDIAVDDIKVLNG
LSMAECKGETFSVTNYTSCSDLSSSAEDITEYPDFVETNQISGPGNMLKTLDPILITIIA
MSALGVFLGAICGVVLYCACSHGGMSDRNLSALENYNFELVDGVKSKKDKLNVQNSYLEA
Download sequence
Identical sequences H3CTI7
ENSTNIP00000011571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]