SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012093 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012093
Domain Number 1 Region: 44-119
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000301
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 106-157
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000131
Family Hairy Orange domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012093   Gene: ENSTNIG00000009228   Transcript: ENSTNIT00000012284
Sequence length 306
Comment pep:known_by_projection chromosome:TETRAODON8:21:4080150:4082766:1 gene:ENSTNIG00000009228 transcript:ENSTNIT00000012284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPQDYSSPDSDTDEFIDVGQEDGFCPVTGSMSPSSTSQILARKKRRGIIEKRRRDRIN
HSLSELRRLVPSAFEKQGSSKLEKAEILQMTVDHLKLLHTVSSKGYFDARALAVDYRTLG
FRECVGEVVRYLSCLDGESTDPVAARLVSHLSHCASELDPLHLQSPPASVLPFPPWPWAS
FPPMAPTSQASPSPPFPGGRRDLALLGSYPSPPTLSMAPLGGCRQAPPALLPPAALAAAH
RVPPLAASAALGPSRPNQASPHSATNPLQVSFRPFAPVGSSAPQRRGISNRASKRVQGWA
TEIGAF
Download sequence
Identical sequences H3CV09
ENSTNIP00000012093 99883.ENSTNIP00000012093 ENSTNIP00000012093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]