SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012270 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012270
Domain Number 1 Region: 254-324
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000115
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 95-145
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000876
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 3 Region: 171-234
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000392
Family Pre-dockerin domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012270   Gene: ENSTNIG00000009401   Transcript: ENSTNIT00000012461
Sequence length 1120
Comment pep:known_by_projection chromosome:TETRAODON8:5:7303950:7308698:-1 gene:ENSTNIG00000009401 transcript:ENSTNIT00000012461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EWTTWFNVDHPGGRGDYEQLEAIRFYYRTRVCASPRAIDARTTEWVPARETGEKVHADPT
VGFWCLNQEQRPGRNCSNYAVRFLCPKGLLLKSSQGTWGPWSEWSPCPALCGDVGVHTRS
RTCQSRSTPCTGPRVEGKECSGPECPQPDCSLLCVMGNVNAECDACTCEEHTLLGSVRGA
GGLVAEGTAVLRSGKLLTVTDHNGHFRIAGICPDGNTTLTFILKGHSTLGATVPRSGERV
SVLSVQLKRTEKLHVLSNPESKVRREGQTAAFCCKVSGAPGPDEYQWFHNDTLLERQSES
TLVLKDLRPEQMGEYYCRARGPSGVIKTKPATLRVLARNEQSCKREPESHLIRLPHDCYQ
NATDSFYYDVGKCPARRCAGHLDSAIRCKDRVAYCCGVQKMEERQLRCQGYQLPTMVVTE
CGCHKCVDTKAIVHGRAIAADNGEPMRFGHIFMDGVRISRTGYRGTFSVQVPPDTERLVL
TFVDNMHKFINTTKVLPFNARGGSVYHEIKLLRKKAPVTISAAEANTLELGEVDGQEAMV
QLQIPPHAFYTEQGDVFTGNVNASVTFLDPRDVSTAAAAQSDLNFVGNQGDVLPLRTYGM
FSVDFRSEETNEPLNAGEVKVFLDSAQVQMPEHVNSMKLWSLNPDTGLWEEEGSLKVEQN
RRGKREERTFLIGNMEIRERRLFNLDVPENRRCYVKVRAFRSERFMPSEQVEGVVVSLIN
MEPAAGYSSNPRAWGRFDSVVTGPNGACLPAFCDEQRADAYTAYVMANLGGEELEAVPSS
PKINPNLIGVPQPYLDKLSYRRSDHEDPRLKKTAFSINVAKPSANTAEEANGPVYAFEQL
KECEEAPFSASHFRFSRVEGDRYDYNTVPFNEDDPMSWTEDYLSWWPKPLEYRACYIKVK
VLSPHELNVRSRNMGGTHPKTVGQLYGLRDTRSIRDMDRANVSAVCLEFKCSGMLYDQER
VDRTLVKVIPQGSCKREQVNPLLMEYLVNHLPLVVNNDTNEFSMLAPLDPLGHNYGIYTV
TDQDPRTAKEIALGRCFDGTSDGTSRVMKSGEGVALTFACGDREVTHQSVFQSGRGQTAS
GTREGRQNRRRQRANTGRSSRGRSTGSRAEPRVSMSPRLQ
Download sequence
Identical sequences H3CVI6
ENSTNIP00000012270 99883.ENSTNIP00000012270 ENSTNIP00000012270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]