SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012279 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012279
Domain Number 1 Region: 21-313
Classification Level Classification E-value
Superfamily L domain-like 4.67e-62
Family Ngr ectodomain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 229-466
Classification Level Classification E-value
Superfamily L domain-like 5.1e-37
Family Ngr ectodomain-like 0.015
Further Details:      
 
Domain Number 3 Region: 55-79,523-811
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.56e-26
Family Rhodopsin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012279   Gene: ENSTNIG00000009409   Transcript: ENSTNIT00000012470
Sequence length 956
Comment pep:known_by_projection chromosome:TETRAODON8:5:7452530:7469319:-1 gene:ENSTNIG00000009409 transcript:ENSTNIT00000012470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCLWCFLRPGATGQGQSAAVCSPSCSCEDGGADCSGRGLTAVPAGLSAFTYYLDLSMNNI
TELPAFVFQNFPYLEELRLAGNDLSFIHPEALSGLHQLKVLMLQNNQLKTVPSRALKNLH
SLQSLRLDANHISAVPEDSFEGLQQLRHLWLDDNNLTEVPVGSLRHQANLQALTLALNRI
SYIPDSAFANLSSLVVLHLHNNRIKEIGDNCFAGLSNLETLDLNFNSLMVFPRAVQALPK
LKELGFHSNDISSIPEGAFHNNPLLRTIHLYDNPLSFVGASAFQNLSELHSLMLRGANMM
QDFPILTWTSNLESLRTLSGTKISSIPAELCEDLKLLRTLDLSYNRITEVPTLQACVRLQ
EINLQHNRIGLIDRDTFQGLSALRLLDLSRNEIRVIHKDAFLSLSALTNLDLSMNSLTLI
PTTGLSSLSQLKLAGNPQMKNVLSAKNLPRLRSISVPYAYQCCAFIGCDLSASASAELQV
KKSTDCCSSTSGGSDVERISMLMHCSPSPGAFKPCEHLLGNWMIRLTVWFICLVSLVFNS
LVLVATFCPAPGGAGRCRPLPAARPVSPWRLLMGLLALANLLTGLYVAVLTVLDAATWGS
FAEFGVWWESGPGCQTAGVLALFSSEWSVLLLALAAVERRVPCRGERRFGLAAALLALLA
ATVACLPLLTSAERSASPLCLPFAGSESPTLSVTVFLVLLNTLAYLFTAGVYTQLYCHLG
RVELADPEQTGALRHVAWLIFTNCIFFCPVAAFSFAPLLTGSTAGGLEIAKSVTLIFFPL
PACLNPVLYVFFSPAFREDWLRLRGRRGRSREAKARANSHGDDSGGASELTDAGSTAHLG
FDCGVYSQLCGEALVCEQCEAALHARTCSSPSSSSICRHLLKSHSCPTLLAGGAACQRSG
GFWADSGTPSAQSEYADEEDSFVSDSSDQVQACGRACFCQSRGLPLVHYSYNIPRD
Download sequence
Identical sequences H3CVJ5
ENSTNIP00000012279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]