SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012550 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012550
Domain Number 1 Region: 820-1123
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.35e-95
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000329
Further Details:      
 
Domain Number 2 Region: 1081-1384
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.11e-81
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000143
Further Details:      
 
Domain Number 3 Region: 4-124
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.17e-28
Family MAM domain 0.0000198
Further Details:      
 
Domain Number 4 Region: 330-535
Classification Level Classification E-value
Superfamily Fibronectin type III 2e-23
Family Fibronectin type III 0.00076
Further Details:      
 
Domain Number 5 Region: 127-230
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000282
Family I set domains 0.0012
Further Details:      
 
Domain Number 6 Region: 223-362
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000382
Family Fibronectin type III 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012550   Gene: ENSTNIG00000009671   Transcript: ENSTNIT00000012741
Sequence length 1387
Comment pep:known_by_projection chromosome:TETRAODON8:8:5866608:5909296:-1 gene:ENSTNIG00000009671 transcript:ENSTNIT00000012741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPSLSPGSYMLVNSSQHAAGHRAQLLLQPMSENDTHCIQFSYFLYSRDGHSPGALRAYVR
VNGGPLGIPVWNASGSQAKQWHPVELAVSTFWPNEYQVLIEATISRERQGYIAVDDIMVL
NYPCYKAPHFSRLGDEEVNAGQNASFQCVAAGRASEAERFLLERHNGETLTAASVKHLSH
RRFVVSFQLDNVQRADQDLYRCVTQSSRGSGVSNFAELIVKVPPSPIAPPQLLRAGSTYL
IVQLNTNSILGDGPIIRKEIEYRASQSPWSEVHAVNMVTYKLWHLDPDTEYHISVLLVSR
TKPEAGPLPPSVPPILTHTASSKPMRALRGLVATDIQPRQLSLQWESLAFNLTRCHTYSV
SLCYRYTTAGGGGGHNTTVRECLAVEHNASRFTLRDLPPYHSVHVRLSLTNPEGKKEGRE
VTFQTDEDIPGGIAPESLTFTPLDDMVFLKWEEPVEPNGLITQYEEQISYQSIESSDPGI
NVPGPRRTVSKLKNETYHMFSNLHPGTTYLISVRARTAKGFGQTALTEITTNISAPTFDY
GDMPSPLSETDSTITVLLRPAQGRGAPVSTYQVVVEEEMVKKVKRELGLQECFPLPMSHG
EAQARGTPHYYTAELPPSSLPEASPFTVGDNHTYNGYWNSPLDPRKSYLVYFQAMSNFRG
ESRINCIRIARKAACKDQRKALEVSQHSEEMGLILGVCAGGLVVLILLLGAVIIIIKKGR
DYLSYYPKPVNMNKTPITYRQEKSHLGSMERSFTDQSTLQEDERMALSFMDAHTCGTRGD
ARSLVNEASSLLGGSPRHQCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEY
ESFFDGWDCTKKKDKTKGRHDTLLGYDRHRVKLHPLLGDPNSDYINANYIDGYHRSNHFI
ATQGPMEETLYDFWRMVWQENCFSIVMITKLVEVGRVKCCKYWPDDSEMYGDIKITLLKT
ETLAEYTVRTFALERRGYSTKHEVRQFHFTSWPEHGVPYHATGLLAFIRRVKASTPPDAG
PVVVHCSVGAGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRINMIQTEEQYVFIHD
AILEACLCGETAIPMNEFAIAYKELLRVDSQSNSSPLREEFQTLNSVTPHLDVEECSIAL
LPRNREKNRSMDVLPPDRALAFLVTTEGESNNYINAALADSFHRQAAFIVTPHPLPGTTA
DFWRLVFDYGCTAVVMLNQLNQSNSAWPCVQYWPEPGLQQYGPMEVEFLSMSADEDVVTR
LFRVKNVTRLQEGQLVVCQFQFLRWSAYRDVPDSKKAFLNLLAQVHKWQRECGEGRTVVH
CLNGGGRSGSFCACNILLEMIQYQNMVDIFYAVKTLRNCKPNMVESLDQYRFCYDLILEY
LDCFDGR
Download sequence
Identical sequences H3CWB6
ENSTNIP00000012550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]