SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012772 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012772
Domain Number 1 Region: 313-391
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.59e-24
Family Intermediate filament protein, coiled coil region 0.0000644
Further Details:      
 
Domain Number 2 Region: 84-119
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000000131
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 3 Region: 94-204
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000759
Family Myosin rod fragments 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012772
Domain Number - Region: 236-294
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.0785
Family Apolipophorin-III 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012772   Gene: ENSTNIG00000009882   Transcript: ENSTNIT00000012964
Sequence length 449
Comment pep:known_by_projection chromosome:TETRAODON8:17:8672817:8675224:1 gene:ENSTNIG00000009882 transcript:ENSTNIT00000012964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGDRYTQSSYRKIFGDSLRLSVSSSRMSRASSGLRAMPPSHGPVSAYRRVGRPSGAFS
VMPAESLDLTQTSVVNNELKVIRTNEKEQLQGLNDRFAMFIDKVRHLEQQNKGLELELAT
LRQRQSEPSRVAQLYQQELKDLRSQVEELGRDKNRFLVERNNVEDELQRLNAKYEEEVKA
REEVEQTLRAFRKDVDDATAVRLDLERRVESLMDEVSFMRKVHDEEIQELSSMMEAQQVS
VELELSKPDLTSALKEIRNQYECIASKNLQSAEEWYKGKFASLSEQASRSNEAMRASREE
LSEFRRQLQSKTIEIETLRGANESLERQISEMEDAHNAEVAAMQDTISQLDTELRSLKGE
MAQHLREYQDLLNVKMALDIEIAAYRKLLEGEETHFNSGMSFSSANYVYQPPRGSAGPSR
SSQREKDGATKESLKGSGEDKDEADVNSN
Download sequence
Identical sequences H3CWY7
ENSTNIP00000012772 ENSTNIP00000012772 99883.ENSTNIP00000012772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]