SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012951 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012951
Domain Number 1 Region: 739-804
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.75e-20
Family TB module/8-cys domain 0.0000725
Further Details:      
 
Domain Number 2 Region: 257-323
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.09e-17
Family TB module/8-cys domain 0.00051
Further Details:      
 
Domain Number 3 Region: 1006-1072
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.03e-16
Family TB module/8-cys domain 0.0018
Further Details:      
 
Domain Number 4 Region: 617-732
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 394-516
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000847
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 138-213
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000128
Family TB module/8-cys domain 0.0023
Further Details:      
 
Domain Number 7 Region: 481-612
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000013
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 8 Region: 903-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000147
Family EGF-type module 0.0027
Further Details:      
 
Domain Number 9 Region: 7-40,166-258
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000377
Family Growth factor receptor domain 0.0056
Further Details:      
 
Domain Number 10 Region: 814-864
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000158
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 11 Region: 957-999
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 12 Region: 1123-1174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000287
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 13 Region: 853-899
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 14 Region: 1093-1137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000195
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012951   Gene: ENSTNIG00000010055   Transcript: ENSTNIT00000013143
Sequence length 1179
Comment pep:known_by_projection chromosome:TETRAODON8:7:5374452:5384291:1 gene:ENSTNIG00000010055 transcript:ENSTNIT00000013143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCLSAVVCPLTCLNGGVCLSRKSCHCPPGFTGRLCQFPLTQTQQAQAARGNKQPVYPMSM
KPDSLKLVGETSIGRTQMTQTHSVFTLPLSQGPHAPEVPFNVRVHHPPDTSVVIYPLDQS
DIKLPHKSSPRIFFTRHKPKGRCFQETTPKQACNSTPLPVLTNQEDCCGSVGNSWGQNKC
YQCPKLPNAPVKQTIVEDSGTTCPQGYKRFNDTHCQDINECIMQVVCQNGDCLNTLGSFK
CSCKAGWVLEGNGCVEAPAEQGQCFLMASESRGCEHALPTYLTQDMCCCTVGKAWGPHCQ
PCPQIGTVAFSKICPAGKGYFYKERREIFAFPPIVYRKPDQDAEIKRPIIMLYSHQTLSN
SSVSIGPTVVKTTPHQVTIIRLTPDNVPFETQTKVSDVDECKLNRNICGHGECESSLNGY
VCHCHHGYHLNQIRNICEDNNECELEPCGHGRGHCVNTDGSFKCLCRQGYKHMVQQGRPK
CIDLNECSKQDICGVRGQCINLPGSYKCECHGGFRIKSHRNPICEDVNECLNPDACPGEL
CENTVGSYECVPCLPGHEARGGTCFADINECLKPGMCPNGHCENLPGTYRCLCNEGFLPS
SDSKGCSDINECEDFRLCANGRCINTEGSFQCQCYSGFQRTQEGSHCEDINECERPSNCL
RGRCINSMGSYHCECQKGYVLVGGRRCQDVDECAADRNLCQPYGTCENRPGSYSCVCNHG
YTLSENKRSCEAIRVFVEEKKECYLNLDDTVFCDSVLATNVTKQECCCSIGVGWGDHCEI
YPCPVSQSAEFHSLCPNGLGLYYDEGLMYSLPAYHDIDECALFAEEICKRGHCENTLPGY
ECYCKKGFYYDSNLLECTDVNECHDESLCAHGHCINTEGSFFCSCNQPWIPDANKKKCVL
ATVIDVNECEDPANCKNGRCVDTPGSYYCICAPPWTLATDRNSCVTPEEQAVSVVPFADV
NECQDPSYCKNGRCENTPGSFHCFCDPPLTFSAALKQCVYDDRTAAHKDVCFLHVDEGLI
CSQPKNDMVVTYSQCCCHYGRGWGPECNTCPPRHSDMFNRLCQMHLETESDGEQDSMAVF
ANYNPAGDSSEEDSDECSCANGRCVRSYLGTMCECNTGFRLDYSRTRCLDIDECTEPGAG
ASPCKNSQCVNTAGSYKCFCKHGFVPARRPNICVHRRTR
Download sequence
Identical sequences H3CXG6
99883.ENSTNIP00000012951 ENSTNIP00000002658 ENSTNIP00000012951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]