SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012959 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012959
Domain Number 1 Region: 179-435
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-42
Family YWTD domain 0.0000258
Further Details:      
 
Domain Number 2 Region: 55-91
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000106
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 91-137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000775
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 4 Region: 12-47
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000038
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012959
Domain Number - Region: 132-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00011
Family EGF-type module 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012959   Gene: ENSTNIG00000010063   Transcript: ENSTNIT00000013151
Sequence length 438
Comment pep:known_by_projection chromosome:TETRAODON8:1:19193344:19197169:-1 gene:ENSTNIG00000010063 transcript:ENSTNIT00000013151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFRCDEMSCHNCTAFSCGQADKCLSRTQLCDGRADCRDGRDESPKLCASSRPNAQACKSS
EFRCGDGPCVAQTYRCDNWKDCADGSDEVDCDQNECAVDNGGCSHGCRDLPLGFICECPR
DMVLVGEYQCEEVDACLDADVCDQVCIPANGSLTCGCHQDYKMSPTTGECKAKGDEARVV
FTSSQGLRWTSISGGESGEPAQQFPGPGLVVGLAANGTLYWAPQGCGTIYRVSMNERNGD
PLPALRVQGPVSGLAVDWIHRLLYWASAGSGSVHVGLLDGSAQRALVAGLQTPSAVAVDP
LHRLLFWAQSGDSPKIERSGLDGRDRKALVTHSIRHPVALSLDLPRQLLYWADQGAKTIS
RVNFEGRHRRTVVESNGYLDRPFGLAVFEGFVYWSDAATGSICRASKHHGRNFTVLLSNA
NSPGGVAIVQSALQPEGT
Download sequence
Identical sequences H3CXH4
ENSTNIP00000012959 ENSTNIP00000012959 99883.ENSTNIP00000012959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]