SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013072 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013072
Domain Number 1 Region: 524-726
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-24
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 2 Region: 301-512
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-23
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 3 Region: 747-951
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-21
Family Laminin G-like module 0.0035
Further Details:      
 
Domain Number 4 Region: 1123-1162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000419
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 5 Region: 1-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000591
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 6 Region: 970-1005
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000643
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 7 Region: 35-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000123
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 8 Region: 73-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000382
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 1043-1080
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000201
Family EGF-type module 0.022
Further Details:      
 
Domain Number 10 Region: 1092-1127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000894
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 234-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000118
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 12 Region: 1006-1046
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000274
Family EGF-type module 0.018
Further Details:      
 
Domain Number 13 Region: 726-776
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000372
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013072
Domain Number - Region: 148-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0159
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013072   Gene: ENSTNIG00000010174   Transcript: ENSTNIT00000013264
Sequence length 1233
Comment pep:known_by_projection chromosome:TETRAODON8:1:19765504:19774829:-1 gene:ENSTNIG00000010174 transcript:ENSTNIT00000013264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSPNPCQNGALCRPRGDGYSCFCVPGFQGPRCQIDVNECASQPCRSGATCLDGRGRFSCL
CPPGLTGATCETQIDECQSQPCLDGDRCRDDPDGFTCICLSGSQGHRCENDTAESGTGLR
ARTERTCEATAATVLLQQKTAAMPLRTSLNSATCPDTRGNHTCQCWPEYPSAPSCDLTSV
CSSSPACTEAGARAMLLSPEESGKHGANMAEEGPWLLLSCDDVTGLWSLCQEVINHCDPD
PCQNGGRCEGRAGGYTCHCLKHVRPGFAYAGPDCEERPVGCEGHACQNQASCVPSLSDGG
PGYACSCPPGHAGPLCATPTTFSFERRGYLVQQSPPVDAGAHCNITLSFRSVLPRAVLFQ
RNSRGLLLSLELDKGRLRLTLGKAGAGGDGLGQVLELPHLVADGEWHSVETVLRSRVFSL
NLLEDSGRCARQPCHKAAPVQSSPDAWASPPQDTVFGGALQHPGGPDPEAPVPPFIGCMR
DVFVDRQPVIPENGLGNSAVNVSPGCSHRDRCLDGPCKNGGECVNLWQSYRCRCPRPYEG
QDCQEELVTARFGSEDAHSYAAFAVSEDLGPDLSVSFFLRTRRPGGFILALGNGSSQYLR
LWLEDGGLAAQLHRLEILKSRSPVDDGTVHFVSLEVEAGRLRLRVADEVQGEVEAGGVAV
EAGHGVSVGELAAGGGTSVFGGSLKGCIQDLRVNDRRLQFFPLDSWVESYPLRLMENVRA
GCSGDDGCRRNPCLNGGTCSSTWDDFTCTCPPQTAGRRCEEVRWCELAPCPADSECRVLN
RGFECYSNATFLNDSTVLTYRGNGHVSRNLTSVSLNLRTRKRNAAVLHAERGSAFITVSV
QDGFLFMELQSAAEAQAASTVSLSSRSGVNDGQWHRLQLFMATPWAPTSRWTLVLDENIE
EASVSRTKAGNLDFLRQDVDIFLGGLAPDAGWALTGCLSTVELGGVALPYLSSSQVNLTR
PQEEQFVQTVCDSKPCLNGGACRDLFNAYSCSCVDGWSGRRCEVLSDACASGPCVHGNCS
ARGPTFECACDFGFAGVNCDEKADVCQNHRCANGGTCLHGPDRYACLCPENFTGPLCRRP
KFPVSVCGDETRNYTCFNGGNCTDRELSCDCPPGFTGHRCEQELDECKSNPCQNGGYCHN
LVNKFVCVCDMSYAGDVCQTDLTPVGPTSDLLLSASLVSVLLLAALLLSSVGLAAAMGRR
ASRGTYSPSRQEKEGSRVEMWSVTQTPPTERLI
Download sequence
Identical sequences H3CXT7
ENSTNIP00000013072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]