SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013503 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013503
Domain Number 1 Region: 245-312
Classification Level Classification E-value
Superfamily Homeodomain-like 1.5e-20
Family Homeodomain 0.0026
Further Details:      
 
Domain Number 2 Region: 79-146
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000178
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 51-78
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000476
Family LIM domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013503
Domain Number - Region: 141-173
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00337
Family LIM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013503   Gene: ENSTNIG00000010590   Transcript: ENSTNIT00000013697
Sequence length 396
Comment pep:novel chromosome:TETRAODON8:Un_random:23823981:23829713:-1 gene:ENSTNIG00000010590 transcript:ENSTNIT00000013697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFHGLPGGDVHGMVEEMDRRGKSESVAISSVIDMGESETPLPCLSGERGALCAGCGRKI
VDRYYLLAVDKQWHMRCLRCCECKLHLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHL
GISASEMVMRARDLVYHLNCFTCTTCSKMLTTGDHFGMKDSLVYCRLHFETLVQGEYQTH
FSHADVVAHKGLGPANTLGLSYFNGVGTVQKGRPRKRKSPGPGAELAAYNAALSCNENDG
ESMDRDSQYSSTQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQ
VWFQNARAKFRRNLLRQESSGVDKASDSSTLQGGTPSGPASEISNASMSPSSTPTTLTDL
SNPTMPTVTSVLTSVPGGMDVHECRSPSQTTLTSLF
Download sequence
Identical sequences Q4SDH5
ENSTNIP00000013503 99883.ENSTNIP00000013503 ENSTNIP00000013503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]