SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013856 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013856
Domain Number 1 Region: 26-124
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.83e-28
Family Chaperone J-domain 0.00035
Further Details:      
 
Domain Number 2 Region: 136-242
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000589
Family Thioltransferase 0.049
Further Details:      
 
Domain Number 3 Region: 247-351
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000914
Family Thioltransferase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013856   Gene: ENSTNIG00000010926   Transcript: ENSTNIT00000014051
Sequence length 784
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:3564605:3568192:1 gene:ENSTNIG00000010926 transcript:ENSTNIT00000014051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGSNMSWSLGVLVLLSVLLMADTNAVPEMDPYKILGVTTDASQAEIKKVYKRLAKEWHPD
KNKHPGAEEMFIKITKSYEILSNEDKRSNYDRYGQTEDTQPYGGSHYSHRHDTFYFEESF
FNFPYGSRSQRDFADSKYILHFNQYVNEVVPNSYKRPYLIKITSDWCFSCIHIEPVWKEV
VQEMESLGVGIGVVDVGYERRLANHLGAHRTPSILGIINGKVTFFHYAVAKVHLRQFVEG
LLPLRLVEQITDKNYQQLLNSWHELNKPHVFLFDQAPAVPLLYKLAAFAYRDYLQFGYVD
QGLSETTDLQKKFNINSYAPTMLVFKENAEKPADIIQAKGMKKQIIDEFMSNNKFLLVPR
LVNQKLFDELCPVKQFHRRRKYCVLLLTGDEEPLSFGNQEFLSFASTNAKEVVRFAYVYS
EHSVCFIAPILKDLKDFALFPQVVILERRNAAGKALFKPVTTWNGSEEDKQRLQDELERL
QKDPSILTHDAMLPELNNEFASMFIIRWIYAFSDYLSEVIDDILHNNWREMMPLLSLIFS
ALFILFGTVVIQAFSDSSEDNQTKAKAKDGTKAENGSPRAGGAPSRAPRKNFVEVTELTD
ITYMSNLVKLRPGQMNVVLLLTDTSKNVLLSKFAKEVYSFTGSLTLHFSFLNIDKHSQWM
DSLLDSSQDAMQIAADVSDGGNHKVDYTGYVLALNGHKKYFCLFKPVYTGEDLDSQTSED
EGTTSGGRSKSGAREEHAARKSSRSRSISTLQIHHKLDRLGLWMERLMEGTLPRYYISAW
PEVD
Download sequence
Identical sequences H3D020
ENSTNIP00000002475 ENSTNIP00000013856 99883.ENSTNIP00000013856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]