SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014131 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014131
Domain Number 1 Region: 224-465
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.78e-79
Family Eukaryotic proteases 0.00017
Further Details:      
 
Domain Number 2 Region: 44-104
Classification Level Classification E-value
Superfamily GLA-domain 4.32e-22
Family GLA-domain 0.00068
Further Details:      
 
Domain Number 3 Region: 90-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000263
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 128-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000991
Family EGF-type module 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014131   Gene: ENSTNIG00000011196   Transcript: ENSTNIT00000014327
Sequence length 506
Comment pep:novel chromosome:TETRAODON8:Un_random:92288475:92291174:1 gene:ENSTNIG00000011196 transcript:ENSTNIT00000014327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPTAAVRLLALLFLSTLARCTVFLDPSSAARVLRPSTRGRRANAFALEELLPGDLEREC
YEETCSQEEAAEIFHTKEKTLEFWFRYVDRNPCRTDPCQNGGMCTVERGAFMCLCPPRYS
GKTCESEVTECRHRNGGCWQYCADVPGGVECGCADGYELEPDGRRCSQTAAFPCGRKQSE
LLYWARSPWNQSALLGAIRTPAHNRTEEQLMALNASQPQHAGNQTAEPMTPRVVGGYLEE
QGGSPWQQVLLRRADGSGFCGGTLISDQWVVSAAHCMQGPVDHVTVGDYDKLRAEPGEQQ
IQVQKVLVHPHFHAFTFDSDVALLRLARPVLRGPTAAPACLPDPHLSKYLLRRGSYGKVT
GWGATRHLGRSSRFLRRVTLPVVSFEDCRASTEQVITDNMFCAGYLDASVDACRGDSGGP
FVVNYRGTWFLTGVVSWGEGCAAEGKFGVYTRLGNFLNWITSTVSKVEANRTQSGGLPQQ
GSDQPWFTCVYWCTAQQQSIMGWKPG
Download sequence
Identical sequences H3D0U5
ENSTNIP00000014131 ENSTNIP00000014131 99883.ENSTNIP00000014131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]