SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014302 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014302
Domain Number 1 Region: 177-253
Classification Level Classification E-value
Superfamily Homeodomain-like 3.85e-18
Family Homeodomain 0.0000608
Further Details:      
 
Domain Number 2 Region: 54-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8e-17
Family LIM domain 0.021
Further Details:      
 
Domain Number 3 Region: 22-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000118
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014302
Domain Number - Region: 117-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00238
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014302   Gene: ENSTNIG00000011357   Transcript: ENSTNIT00000014500
Sequence length 362
Comment pep:known_by_projection chromosome:TETRAODON8:5:2521581:2525026:-1 gene:ENSTNIG00000011357 transcript:ENSTNIT00000014500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDIIFSSSFLGDMGDHSKKKQGFAMCVGCGSQIHDQYILRVSPDLEWHAACLKCAECSQ
YLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCNLGFSSSDLVMRARDHVYHIECFRCSVC
SRQLLPGDEFSLREEELLCRADHSLLLERSSAGSPISPGHIHSNRPLHLTGPPLLPFSLQ
AGPHRNHVHKQSEKTTRVRTVLNEKQLHTLRTCYNANPRPDALMKEQLVEMTGLSPRVIR
VWFQNKRCKDKKKAQLMKQLQQQQHSDKTNLQGLTGTPLVAGSPIRHESAVGNPVEVQTY
QPPWKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPV
ET
Download sequence
Identical sequences H3D1B6
ENSTNIP00000014302 99883.ENSTNIP00000014302 ENSTNIP00000014302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]