SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014849 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014849
Domain Number 1 Region: 51-166
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-32
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 2 Region: 182-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-19
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 303-339
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014849   Gene: ENSTNIG00000011891   Transcript: ENSTNIT00000015050
Sequence length 525
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:92870337:92877253:1 gene:ENSTNIG00000011891 transcript:ENSTNIT00000015050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEKLTCSVFPLVWILFFLMEEAFALAQRTKAFPLQDSPIEHGGQSPNQNDCGTWVRNIN
GGVFTSPNYPNTYPPNKECVYILEALPRQRIQLAFDKNYYIEPSFECRFDHIEIRDGPFG
FSPLIDRFCGGKNPGLVTSTGRFMWIKFTSDEELEGLGFRIKYTFIADPDFHLHVGGLLN
PIPDCQFDISGWDGVIRSSQVEEQERVKPGDALDCIWTIRAPPQSKIYLRFMEYQMEHSN
ECKKNFVAVYDGSSAIENLKAKFCSTVANDVMLDNGVGVVMWADEKSRLSRFRMLFTSFV
DPPCSANTFFCHSNMCINNSLVCNGVQNCVYPWDENHCKEKRSAGLFHQITKTHGTVIGV
SSGIVLVLLIISILVQMKQPRKKVVARRPGVFNKAGFQEVFDPPHYELFSLRDKEVSSDL
ADLSEELDSFHKLRRSSTMSRCVHEHHCGSQGSVAKHSRTTLSSMELSYHNDFSKPPPMK
TFNSTTSYKKSCYGYKQHAQTHDCDQQVIEDRVTEEIPCEIYGRG
Download sequence
Identical sequences H3D2W1
99883.ENSTNIP00000014849 ENSTNIP00000014849 ENSTNIP00000014849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]