SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015051 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015051
Domain Number 1 Region: 317-395
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.33e-25
Family Intermediate filament protein, coiled coil region 0.000046
Further Details:      
 
Domain Number 2 Region: 88-124
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000068
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 140-231
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000837
Family Myosin rod fragments 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015051
Domain Number - Region: 227-298
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.0732
Family Apolipophorin-III 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015051   Gene: ENSTNIG00000012087   Transcript: ENSTNIT00000015253
Sequence length 483
Comment pep:known_by_projection chromosome:TETRAODON8:18:5906971:5908913:-1 gene:ENSTNIG00000012087 transcript:ENSTNIT00000015253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYGAEVYSSSSYRKIFGDSPRYASSPSRNLSSRGGYRYSSSSSVGRSNISSLGAHSRKS
GRSLAMPLDTVDLAQSSVLNNEFKIIRTNEKEQMQGLNDRFAMFIEKVHNLEQHNKMLET
ELSALRQRQAEPSRLADIYQQEIRELRSQLEELNGEKSQLLIERDNIEDDLQKLRGKYEE
EFRAREEAEATLKAFKKDVDDATMVRLDLEKKVESLLDEINFLRKVHEEEVAELMDMIQA
AQVSVEMEVSKPDLTSALKEIRGQYESMASKNLQSAEEWYKSKFNDLSEQAVRSNEAIRA
SREEMNEYRRQLQSKTIEIESLRGTNESLEKQLRDMEDRHNVEIGNYQDGMAELENELRT
TKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRIGTGITYPGPSGGGGAMQSYG
YQSRVYTSSSRGAKKEGKDEEQPQQSKPGAKTSQREVYEETVITTKKTEKQQDAGDVPTN
QKN
Download sequence
Identical sequences H3D3G3
ENSTNIP00000015051 ENSTNIP00000015051 99883.ENSTNIP00000015051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]