SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015473 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015473
Domain Number 1 Region: 668-855
Classification Level Classification E-value
Superfamily Sec7 domain 7.46e-65
Family Sec7 domain 0.00000586
Further Details:      
 
Domain Number 2 Region: 871-1002
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-18
Family Pleckstrin-homology domain (PH domain) 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015473   Gene: ENSTNIG00000012504   Transcript: ENSTNIT00000015679
Sequence length 1310
Comment pep:known_by_projection chromosome:TETRAODON8:9:8989598:9007719:-1 gene:ENSTNIG00000012504 transcript:ENSTNIT00000015679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVEAQRPTMENSTESPNRAVEYLLELNNIIESQAKLLETQRRRIEELEGQLDRVSQENQD
LRQERSPRTPGSDPPEQDHNHSQPLSLPIHHRHIRENQIRENIFNTFRNQKEGWKEGEEV
EHTLMDHLSTGDATVAAACGCRLPRELLLIQLGGETAGEAGDPAESLAGCRGYKPVPQRP
SRSGALLASGGSRCLEGGGGGSKSTVTRSRRACLTQKKSVEGESQFADPSTRKDSSFKQS
LYRSERYTDSGGGAPSGSSLAWVLRTRHQPASLALRKQEEEEHKRCKALSDSYELSTDLQ
DKKVEMLERKYGGSFVSRRAARTIQTAFRQYRMNKNFERLRSSASESRMTRRIILSNMRL
QYSFDERQPQQQAQTQTSFTHSVAIGPPHSPDPDRPEDYTHLEDSFSKQVKSLADSIDDA
LTCRGARNDSQEGSSMHGDSTATSYSDVTLYMDDGMPSSPLSLDRAPSSTDTEYWGPGGG
VGGREDSRDTEGGGSSNSRRSTPCTECRDFRFRGAHLPLLTIEPPSDSSVDMSDRSDRGS
LSRQLVYEQERSPQGTLKHAANTGRPHFHYPDTPSSSSSPQQPPTTPLSSSSSTALPPGG
LEQPCCSDGDNDSLNSTTNSNETVNCSSGSSSQDSLQEPLPPLGKQTYQRETRHSWDSPP
FNSDVVQRRQYRIGLNLFNKKPEKGIQYLIERGFVSDTPVGIARFILERKGLSRQMIGEF
LGNRQKQFNKDVLDCVVDEMDFSGMDLDDALRKFQAQIKVQGEAQKVERLIEAFSQRYCV
CNPALVRQFQNPDTIFILAFAIILLNTDMYSPNVKAERKMKLEDFIKNLRGVDNGQDIPR
DLLVGIYQRIQKWELRTNDDHVSQVQAVERVIVGKKPVLSLPHRRLVCCCQLYEVPDPNR
PQRTGVHQREVFLFNDLLVVTKIFQKKKTSVTYSFRQSFSLVEMQVHMFQNSYYPHGIRL
TSAILGGERKVLIVFMAPSQQDRTRFVSDLRESIAEVQEMEKYRVESELEKQKGVMRPSL
LSGGVVGGGVGVKSDVVNGTLGRTSFEDNCSVGEGLKRTALSSSLRDLSDTGKHGRRNSV
GSLDSTMEGSIISSPQPHQRYPLPERAGAGNNPGGSSASNNSGSFLGSLFGSKRAKPPGP
LIPPGPPFPAPVPPPTTGGPPPHSPSSLCQMDGGPSKIQALHAQFCHTGGVQPPPPYYHH
HRFHVQPVQPPLQGLPPHTIQRGPLPCRPVLGPPHTQHLQLAHLSQLSQSGLPGRYGNIV
VGCPPPLSPRGRRPWYQTATHPVHTPHPTTHSTHQTHFIFGTLPQKLPSA
Download sequence
Identical sequences H3D4N5
ENSTNIP00000015473 99883.ENSTNIP00000015473 ENSTNIP00000015473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]